Loading...
HomeMy WebLinkAboutResolution 33-25RECORD OF RESOLUTIONS BARRETT BROTHERS - DAYTON, OHIO Form 6301 Resolution No. 33-25 Passed ; ACCEPTANCE OF A PRELIMINARY PLAT FOR THE SUBDIVISION OF 14.2 ACRES INTO 20 SINGLE-FAMILY LOTS WITH 5.8 ACRES OF OPEN SPACE AND DEDICATION OF RIGHT-OF-WAY (CASE 24-151PP) WHEREAS, application for approval of the preliminary plat for Bright Road Reserve development, has been made under Chapter 152 of the Codified Ordinances of the City of Dublin; and WHEREAS, the Council has considered the recommendation of the Planning and Zoning Commission, the reports of staff, and the subdivision requirements of Chapter 152 of the Codified Ordinances of the City of Dublin, and desires to approve said plats and accept all rights of way, easements, and other interests dedicated to the City therein; NOW, THEREFORE, BE IT RESOLVED by the Council of the City of Dublin, State of Ohio, [ of the elected members concurring that: Section 1. The City Council hereby approves and accepts the preliminary plat for Bright Road Reserve development, attached hereto and incorporated by reference as Exhibit A. Section 2. The City Manager, Law Director, Clerk of Council, and any other required City employee or official are authorized to execute the plat on behalf of the City. Section 3. Pursuant to Section 4.04 of the Charter, this resolution shall take effect immediately upon passage. Passed this _/ qe _| 17 _ day of Mn Aeg , 2025. MN A-2- Mayor — Presiding Officer ria of Coll (] To: Members of Dublin City Council From: Megan O’Callaghan, City Manager Date: May 13, 2025 Initiated By: Jennifer M. Rauch, AICP, Director of Community Planning & Development Paul A. Hammersmith, PE, Director of Engineering/City Engineer Rati Singh, Assoc. AIA, Planner I Re: Resolution 33-25 –Acceptance of a Preliminary Plat to subdivide approximately 14.2 acres (PID 273-008618 and PID 273-011149) into 20 single-family lots for the future development of Bright Road Reserve (Case 24-151PP). Summary This is a request to accept a Preliminary Plat for the Bright Road Reserve Subdivision, which will establish 20 single-family lots, two public rights-of-way, and 5.8 acres of public open space as a Planned Unit Development in alignment with Ordinance 04-25, the Rezoning/Preliminary Development Plan approved at the March 17, 2025, City Council meeting. Process As provided by the Law Director’s Office, when City Council approves preliminary and final plats, the process is solely to identify property lines, establish easements, dedicate open space, and create public rights-of-way. The site layout, architectural character, and open space designs for the development are part of separate application processes, approved by the required reviewing bodies. Background The Planning and Zoning Commission reviewed an application for a Preliminary Plat and made a recommendation of approval to City Council on February 6, 2025 finding the proposal meets the review criteria. This application was reviewed in conjunction with the Rezoning/Preliminary Development Plan, which the Commission also recommended approval to City Council. Description This is a proposal for a Preliminary Plat for the subdivision of 14.2 acres of land, which includes the creation of 20 single-family lots, four open space reserves, and two public streets. The Preliminary Plat shows existing conditions, proposed development sections, setback requirements, lot depths and widths. It also includes the open space acreages, ownership, and maintenance responsibilities. The single-family lots range in size, with the smallest lot at 9,960 square feet and the largest lot at 21,433 square feet. The minimum lot width is 29 feet (Lot 5), and the minimum lot depth is 107 feet (Lot 19). Single-family residential setbacks are not platted but rather are defined by the development text. Two new public streets are proposed with the development. Bright Reserve Way is proposed to provide access to the development from Bright Road and is a 50-foot-wide right-of-way (26-foot- wide pavement) extending from the Bright Road intersection to the first internal intersection. The Community Planning & Development 5200 Emerald Parkway • Dublin, OH 43017 Phone: 614-410-4600 • Fax: 614-410-4747 Memo Memo re. Res. 33-25 Bright Road Reserve Plat May 13, 2025 Page 2 of 3 remainder of this street, as well as the second proposed street, Stillwater Loop, would have a 40- foot-wide right-of-way (24-foot-wide pavement). The plat establishes a 15-foot front building line for each lot along the public right-of-way and shows associated utility easements. A 20-foot tree preservation zone was established and approved with Ordinance 04-25. According to the approved development plan, existing trees within the Tree Preservation Zone are to be preserved, with the possible exception of trimming or removal based on the condition of individual plants and sound arboricultural practices. The Tree Preservation Zone is established to protect these existing stands of trees, ensuring that no work will be performed within the zone that could alter its natural state or damage the trees or vegetation present. The proposed plat indicates a 20-foot landscape easement along the northern and southern property lines, which overlaps with the designated Tree Preservation Zone. The designated Tree Preservation Zone serves as a buffer between the proposed development and the existing neighborhoods, and staff recommends the plat be revised to locate the easements outside the Tree Preservation Zone to meet the approved development requirements. As part of City Council’s approval of the Rezoning/Preliminary Development Plan in March 2025, the applicant initially requested to provide sidewalks on only one side of the street. However, City Council required sidewalks on both sides in accordance with city standards. The applicant proposes providing a four-foot sidewalk on both sides of the proposed streets, citing the minimum requirement outlined in the City’s subdivision regulations for sidewalk width. However, this approach does not align with the higher design standards required for Planned Unit Developments (PUDs), which aim to promote a higher quality of development. Although subdivision regulations set four feet as the minimum sidewalk width, the City’s street cross-section and Envision Dublin policies recommend six-foot sidewalks. Staff recommends a compromise of five-foot sidewalks on both sides of the street to ensure compliance with the approved development text and to maintain consistency throughout the neighborhood. Additionally, the applicant proposes a 3.5-foot-wide tree lawn, and staff also recommends the plat be revised to include a five-foot-wide tree lawn on both sides of the street. The Subdivision Regulations require land dedication for open space and for recreational facilities. The applicant is required to provide a minimum of 0.88-acres for open space for the site based on the area and number of single-family lots. The proposal is for 5.8 acres of open space, all of which is to be dedicated to the City. Four reserves of open space are proposed to be established. Details are as follows: Ownership and Maintenance of Public Open Spaces Space Ownership Maintenance Reserve A: 2.4-acre (West Wood) City of Dublin HOA* *City of Dublin will maintain the stormwater functionality of the detention basin Reserve B: 3.11-acre (Billingsley Run) City of Dublin HOA** **City of Dublin will maintain the waterway Reserve C: 0.29-acre (Central Court) City of Dublin HOA Reserve D: 0.027-acre (East Court) City of Dublin HOA Memo re. Res. 33-25 Bright Road Reserve Plat May 13, 2025 Page 3 of 3 Recommendation of the Planning and Zoning Commission At the February 6, 2025 Planning and Zoning Commission meeting, Staff recommended approval to the Commission with conditions. The Planning and Zoning Commission recommended approval to City Council with conditions. Preliminary Plat Conditions: 1) The applicant ensure that the site survey, easements, grading, and engineering comments are shown on the plat prior to City Council submittal. 2) The applicant address any other technical adjustment as needed. The applicant has addressed all conditions with slight modifications, as detailed in conditions 2 and 3 below. The applicant will continue to collaborate with staff to address these conditions. Recommendation Acceptance of Resolution 33-25 with the following conditions: 1) The plat should be revised to provide a 5-foot wide sidewalk on both sides of the streets and any associated easements needed for construction and maintenance. 2) The plat should be revised to provide a consistent 5-foot-wide tree lawn between the curb and the sidewalk throughout the development. 3) The plat should be revised to remove the easements from the designated Tree Preservation Zone on Lots 5-7. 4) The applicant addresses any other technical adjustments as needed on the Final Plat. DUBLIN CITY OF COLUMBUS BRIGHT ROAD MAC D U F F P L A C EMACBETHDRIVE HANNA HILLS DRIVE BRIGHT ROAD GRANDEE CLIFFS DRIVE6 3 2 1 13 19 14 1617 18 4 7 8 9 10 11 12 5 20 15 BM RESERVE "A"RESERVE "C"RESERVE "D" RESERVE "B"BRIGHT RESERVES T ILLW A T ER LOOP WAYDrawing Number: Project Number:ADVANCEDCIVILDESIGNENGINEERSSURVYEORSDrawn By: Date: Scale: Checked By:PRELIMINARY NOTFOR CONSTRUCTIONFINAL DEVELOPMENT PLANBRIGHT ROAD RESERVECFH BR LAND ACQUISITION LLC6045 MEMORIAL DRIVEDUBLIN, OHIO 43017VICINITY MAP PRELIMINARY PLAT FOR BRIGHT ROAD RESERVE CITY OF DUBLIN, FRANKLIN COUNTY, OHIO INDEX MAP SHEET INDEX FLOODPLAIN LEGALLANDOWNER DEVELOPER ENGINEER & SURVEYOR LAND PLANNING/LANDSCAPE ARCHITECTURE ARCHITECTURE 800-362-2764 or 8-1-1 Before You Dig SITE GRAPHIC SCALE 0 1 inch = 100 feet 20050100 1 / 5 TITLE SHEET/VICINITY MAP/REGIONAL INDEX MAPUTILITY & SERVICE CONTACTS BENCH MARK ADVANCED C I V I L D E S I G N E N G I N E E R S S U R V YE O R S PREPARED BY: SITE STATISTICS SITE ACREAGE STILLWATER LOOPBRIGHT RO A D GRANDEE CLIFFS DRIVEBRIGHT ROAD BRIGHT RESERVE WAYS T IL LW A T ER LO OP (4 0 ' R /W )(40' R/W)(40' R/W)(50' R/W)Drawing Number: Project Number:ADVANCEDCIVILDESIGNENGINEERSSURVYEORSDrawn By: Date: Scale: Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY PLATBRIGHT ROAD RESERVE3 / 5 PRELIMINARY PLAT/DEVELOPMENT PLANGRAPHIC SCALE 0 1 inch = 50 feet 1002550 NOTES: RESERVE OWNERSHIP AND RESPONSIBILITY BRIGHT R O A D GRANDEE CLIFFS DRIVE6 3 2 1 13 19 14 1617 18 4 7 8 9 10 11 12 5 20 15STILLWATER LOOPS T IL L W A T ER LOO P (4 0 ' R /W )(40' R/W)(40' R/W)(50' R/W)BRIGHT RESERVE WAYDrawing Number: Project Number:ADVANCEDCIVILDESIGNENGINEERSSURVYEORSDrawn By: Date: Scale: Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY PLATBRIGHT ROAD RESERVEUTILITY PLANGRAPHIC SCALE 0 1 inch = 50 feet 1002550 NOTES:LEGEND 4 / 5 BRIGHT R O A D GRANDEE CLIFFS DRIVE6 3 2 1 13 19 14 16 17 18 4 7 8 9 10 11 12 5 20 15STILLWATER LOOPBRIGHT RESERVE WAYS T I L L W A T E R L O O P (4 0 ' R /W )(40' R/W)(40' R/W)(50' R/W)Drawing Number: Project Number:ADVANCEDCIVILDESIGNENGINEERSSURVYEORSDrawn By: Date: Scale: Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY PLATBRIGHT ROAD RESERVEGRADING AND DRAINAGE PLANGRAPHIC SCALE 0 1 inch = 50 feet 1002550 LEGENDNOTES: 5 / 5 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX868889221919294879596971131811792012001992475855545372717078767779808112131130141628292726221831333441404547485150494668668283564318485223225215240232127615956657910875744373423244393537362513813914016616716914212812912610510423924624524124424324221118718517118916516414116317316116015813413313113014814915011912312212110610710811711611011111511411215315215114716817013713613212412513514414317218614514610910310210110099989320320218090220219218204205217216224222184182183154155156177178175174159157226229230227228202231233234235238213212206207208209210193192190188194191198197196195523815242321201917257606369676264120118162176AREAS TO BE AUGMENTED WITHADDITIONAL PLANTINGS THROUGHREFORESTATION / REPLACEMENTPROGRAM. FINAL PLANT LOCATIONS TO BEDETERMINED DURING FINAL DEVELOPMENTPLAN PROCESS TO ENSURECOORDINATION WITH SITEINFRASTRUCTURE AND GRADING. FINALLANDSCAPE PLAN TO BE COORDINATEDWITH CITY FORESTER.LANDSCAPEEASEMENT AREA(TYP.)AREAS TO BE AUGMENTED WITHADDITIONAL PLANTINGS THROUGHREFORESTATION / REPLACEMENTPROGRAM. FINAL PLANT LOCATIONS TO BEDETERMINED DURING FINALDEVELOPMENT PLAN PROCESS TO ENSURECOORDINATION WITH SITEINFRASTRUCTURE AND GRADING. FINALLANDSCAPE PLAN TO BE COORDINATEDWITH CITY FORESTER.LANDSCAPEEASEMENT AREA(TYP.)PROPOSED STREETTREE PLANTINGS(TYP.)PROPOSED TREEPLANTINGS INCENTRAL COURTAREAS OF TREEPRESERVATION, EXISTINGTREES NOT YET SURVEYED.TREE LEGENDL0.01TREE PRESERVATIONPLANBRIGHT ROADRESERVE4338 Bright RoadDublin, Ohio43016consultant 1Advanced Civil Design781 Science BoulevardSuite 100Gahanna, Ohio, 43230p 614.428.77554338 BRIGHT ROAD PARTNERS, LLCrevisionPRELIMINARYsealNot For ConstructionX:\Columbus\2024\c24044-Bright Road Development\BIM_CAD_GIS\CAD\Sheets\Tree Preservation Plan\Tree Preservation Plan.dwg May 08, 2025 - 11:35am-jbrocklehurst client / ownerproject nameproject addressdateissuedissue date05.08.2025project numberc24044sheet namesheet number462 SOUTH LUDLOW ALLEYCOLUMBUS, OH 43215614.621.2796 MKSKSTUDIOS.COMEXISTING TREE - PROTECT-IN-PLACEN.T.S.TREE PROTECTION ZONE - 4 FT. HT.KEEP OUTTREEPROTECTIONZONETREE PROTECTION AREA. REFER TO PLAN4'-0"18" MIN.8'-0" MAX.NOTE:1.REFER TO SECTION 01 56 39 - TEMPORARY TREEAND PLANT PROTECTION FOR FENCING ANDPRUNING REQUIREMENTS.2.PRUNING OF TREES SHALL BE PERMITTED ONLY ATTHE DIRECTION OF THE APPROVED AND CERTIFIEDARBORIST.3.NO EQUIPMENT SHALL BE PERMITTED INSIDE THEPROTECTIVE FENCING INCLUDING DURING FENCEINSTALLATION AND REMOVAL4.FENCE TO REMAIN IN PLACE THROUGH ENTIRETY OFCONSTRUCTION.PLASTIC PROTECTION-ZONE FENCINGT-SHAPE, GALVANIZED POST, 3-QTYWIRE TIES PER POSTMAINTAIN EXISTING GRADE AT THE TREEPROTECTION FENCEPROTECTION ZONE SIGNAGE PANELSIZE: 12x18", ALL CAP LETTERINGPAINTED RED ON WHITE BACKGROUND.REFER TO SOIL PLANS FOR AMENDINGSOIL WITHIN THE DESIGNED TREEDRIPLINE040'80'N20'XEXISTING TREE - TO BE REMOVEDEXISTING TREE - PROTECT-IN-PLACE(YET TO BE SURVEYED)XEXISTING TREE - TO BE REMOVED(YET TO BE SURVEYED) L0.02EXISTING TREE DATABRIGHT ROADRESERVE4338 Bright RoadDublin, Ohio43016consultant 1Advanced Civil Design781 Science BoulevardSuite 100Gahanna, Ohio, 43230p 614.428.77554338 BRIGHT ROAD PARTNERS, LLCrevisionPRELIMINARYsealNot For ConstructionX:\Columbus\2024\c24044-Bright Road Development\BIM_CAD_GIS\CAD\Sheets\Tree Preservation Plan\Tree Preservation Plan.dwg May 08, 2025 - 11:33am-jbrocklehurst client / ownerproject nameproject addressdateissuedissue date05.08.2025project numberc24044sheet namesheet number462 SOUTH LUDLOW ALLEYCOLUMBUS, OH 43215614.621.2796 MKSKSTUDIOS.COM#COMMON NAMEDBHCONDITION1*FRUITING PEAR17.0FAIR#COMMON NAMECONDITION51*FRUITING PEARDBH15.02RED MAPLE6.0FAIR52PIN OAK25.03*SUGAR MAPLE17.0POOR53RED MULBERRY8.04*SUGAR MAPLE 14.0POOR54BLUE SPRUCE10.05RED MAPLE9.0FAIR55*WHITE SPRICE9.06RED MAPLE14.0FAIR56BLUE SPRUCE12.07RED MULBERRY26.0FAIR57BLACK WALNUT6.08RED MAPLE11.0FAIR58BLACK WALNUT8.09BUTTERNUT20.0FAIR59NORWAY SPRUCE16.010*FRUITING PEAR17.0POOR6014.011BUTTERNUT26.0GOOD6110.012RED MAPLE9.0GOOD6212.013AMERICAN SYCAMORE28.0GOOD6313.014EASTERN HEMLOCK8.0GOOD649.015BLUE SPRUCE6FAIR6513.016RIVER BIRCH13.0FAIR6613.017NORTHERN RED OAK28.0GOOD679.018*AUSTRIAN PINE13.0POOR6810.0199.0POOR696.0208.0POOR70RED MAPLE12.0218.0POOR71SILVER MAPLE19.022HONEYLOCUST15.0GOOD72EASTERN WHITE PINE16.023HONEYLOCUST16.0GOOD73*CALLERY PEAR11.024AUSTRIAN PINE16.0FAIR74EASTERN WHITE PINE18.025HONEYLOCUST16.0GOOD7529.026*HONEYLOCUST16.0POOR76RED MAPLE9.027HONEYLOCUST35.0FAIR77RED MAPLE12.028HONEYLOCUST14.0FAIR78*FRUITING PEAR10.029HONEYLOCUST13.0FAIR79*RED MAPLE10.030RED MAPLE9.0FAIR8010.031BALD CYPRESS15.0FAIR8110.032AMERICAN SYCAMORE44.0GOOD8210.033JAPANESE RED PINE9.0FAIR839.034EASTERN REDBUD30.0FAIR8414.035BLACK WALNUT20.0GOOD8511.036BLACK WALNUT18.0GOOD86BLACK WALNUT16.037HICKORY - SHAGBARK10.0GOOD87EASTERN WHITE PINE21.038HICKORY - SHAGBARK14.0GOOD88*AMERICAN ELM6.039NORWAY SPRUCE17.0FAIR89*AMERICAN ELM10.040*CHERRY SPECIES10.0POOR90AMERICAN ELM11.041EASTERN COTTONWOOD40.0GOOD91SUGAR MAPLE6.042AMERICAN SYCAMORE30.0FAIR92AMERICAN ELM8.043*SILVER MAPLE41.093*ASH19.044AMERICAN SYCAMORE30.094KENTUCKY COFFEETREE20.045RED MAPLE 12.09518.046RED MAPLE10.096*BOXELDER10.047BLUE SPRUCE10.097SUGAR MAPLE12.048RED MAPLE11.098SUGAR MAPLE8.049*BLACK CHERRY10.099BLACK WALNUT18.050*FRUITING PEAR8.0100SUGAR MAPLE6.0#COMMON NAMECONDITIONDBH101SUGAR MAPLE8.0102AMERICAN ELM10.0103BLACK WALNUT19.01047.010514.010619.010724.0108AMERICAN ELM20.0109*BLACK CHERRY6.0110SUGAR MAPLE9.011115.011216.011320.011430.0115SUGAR MAPLE10.0116BLACK WALNUT15.0117HONEYLOCUST23.0118119SUGAR MAPLE9.0120*AMERICAN ELM6.0121BLACK WALNUT20.0122SUGAR MAPLE11.0123*BLACK CHERRY10.0124SUGAR MAPLE6.0125*AMERICAN ELM9.0126HONEYLOCUST39.0127HONEYLOCUST10.0128*SUGAR MAPLE6.0129SUGAR MAPLE12.0130SUGAR MAPLE10.0131*ASH14.0132SUGAR MAPLE10.0133SUGAR MAPLE8.0134SUGAR MAPLE9.0135BLACK WALNUT23.0136AMERICAN ELM9.0137BOXELDER6.0138AMERICAN ELM7.0139AMERICAN ELM8.0141AMERICAN ELM17.01427.014310.01446.0145SUGAR MAPLE15.0146BLACK WALNUT18.0147*AMERICAN ELM8.0148SUGAR MAPLE10.0149SUGAR MAPLE10.0150*BLACK CHERRY9.0#COMMON NAMECONDITION151AMERICAN ELMDBH9.0152BLACK WALNUT19.0153*BLACK CHERRY7.0154*BLACK CHERRY6.0155AMERICAN ELM6.0156BLACK WALNUT22.0157AMERICAN ELM8.0158AMERICAN ELM8.0159BLACK WALNUT16.0160SUGAR MAPLE8.0161SUGAR MAPLE7.0162AMERICAN ELM16.0163BLACK WALNUT17.0164SUGAR MAPLE8.0165AMERICAN ELM6.0166AMERICAN ELM9.0167NORTHERN HACKBERRY11.01686.0169BLACK WALNUT35.01707.017112.01727.01736.01748.017510.01768.0177*AMERICAN ELM6.0178SUGAR MAPLE7.0179BLACH CHERRY10.0180*AMERICAN ELM6.0181*BLACK CHERRY8.0182*BLACK WALNUT16.0183*AMERICAN ELM12.0184BLACK WALNUT24.0185BLACK WALNUT20.0186*AMERICAN ELM6.0187BLACK WALNUT8.0188NORTHERN HACKBERRY9.0189*NORTHERN HACKBERRY8.0190BLACK WALNUT19.0191BLACK WALNUT17.0192*BLACK WALNUT8.0193BLACK WALNUT12.0194AMERICAN ELM8.0195BLACK WALNUT27.0196BLACK WALNUT9.0197BLACK WALNUT9.0198*AMERICAN ELM7.0199BLACK WALNUT18.0200AMERICAN ELM7.0#COMMON NAMECONDITIONDBH201AMERICAN ELM6.0202AMERICAN ELM8.0BLACK WALNUT18.0AMERICAN ELM8.0AMERICAN ELM12.0HONEYLOCUST21.0AMERICAN ELM9.0*SUGAR MAPLE8.0HONEYLOCUST18.0*AMERICAN ELM11.0AMERICAN ELM11.0BLACK WALNUT23.0BLACK WALNUT20.0*AMERICAN ELM6.0AMERICAN ELM6.0BLACK WALNUT28.0KENTUCKY COFFEETREE22.0AMERICAN ELM15.0SUGAR MAPLE15.0SUGAR MAPLE15.0AMERICAN ELM15.0SUGAR MAPLE15.0AMERICAN ELM15.0EASTERN WHITE PINE13.012.018.015.015.08.022.020.013.016.014.017.0*EASTERN WHITE PINE10.0BLACK WALNUT13.0*RED MULBERRY11.011.010.012.0AMERICAN ELM7.0NORTHERN HACKBERRY16.0BLACK WALNUT11.0*FLOWERING CRABAPPLE72.0POORGOODGOODGOODGOODGOODDEADPOORFAIRGOODFAIRFAIRPOORFAIRFAIRFAIRGOODGOODGOODGOODGOODFAIRGOODFAIRFAIRGOODGOODFAIRPOORFAIRGOODFAIRFAIRDEADDEADFAIRGOODFAIRFAIRFAIRFAIRGOODFAIRPOORFAIRGOODFAIRFAIRFAIRFAIRPOORFAIRDEADFAIRGOODGOODGOODGOODGOODGOODGOODFAIRFAIRGOODFAIRGOODGOODFAIRFAIRFAIRPOORFAIRFAIRFAIRPOORPOORPOORGOODGOODDEADDEADFAIRGOODGOODDEADGOODFAIRPOORGOODGOODGOODFAIRGOODGOODGOODFAIRFAIRGOODFAIRPOORFAIRGOODDEADGOODGOODGOODFAIRFAIRPOORGOODPOORFAIRFAIRFAIRFAIRGOODGOODPOORFAIRFAIRFAIRGOODGOODGOODGOODGOODFAIRDEADGOODFAIRPOORGOODGOODDEADGOODGOODGOODGOODPOORFAIRPOORFAIRFAIRPOORPOORPOORPOORFAIRFAIRPOORGOODFAIRFAIRFAIRPOORFAIRPOORGOODFAIRPOORGOODFAIRFAIRFAIR FAIRFAIRFAIRFAIRFAIRFAIRGOODGOODDEADGOODFAIRFAIRPOORGOODGOODPOORFAIRFAIRGOODFAIRFAIRPOORFAIRPOORFAIRPOORPOORFAIRPOORFAIRFAIRFAIRPOORFAIRFAIRFAIRPOORNORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCEEASTERN WHITE PINERED MAPLERED MAPLERED MAPLE*RED MAPLE*RED MAPLE*RED MAPLEKENTUCKY COFFEETREEBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTSUGAR MAPLE9.0FAIR140AMERICAN ELM8.0FAIRSUGAR MAPLESUGAR MAPLESUGAR MAPLE*NORTHERN HACKBERRY*NORTHERN HACKBERRYNORTHERN HACKBERRYAMERICAN ELM*AMERICAN ELMAMERICAN ELMAMERICAN ELMAMERICAN ELM203204205206207208209210211213214215216217218219220221222223224225226227228229230231232233234235236237238239240241242243244245246247BLACK WALNUT19.0GOOD212KENTUCKY COFFEETREE21.0FAIREASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINE*EASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINE*EASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINE*BOXELDER*EASTERN WHITE PINEEASTERN WHITE PINE*EASTERN WHITE PINETREES TO BE REMOVED (FAIR & GOOD)873"SUMMARY - TREE REMOVAL*TREES IN POOR CONDITION OR DEAD WILL NOT BE REPLACED.*PEAR & ASH TREES WILL NOT BE REPLACED.*AUSTRIAN PINE*AUSTRIAN PINE*AUSTRIAN PINE 5200 Emerald Parkway Dublin, Ohio 43017 Community Planning and Development Sustainable | Connected | Resilient 614.410.4600 dublinohiousa.gov DRAFT RECORD OF ACTION Planning and Zoning Commission Thursday, February 6, 2025 | 6:30 p.m. The Planning and Zoning Commission took the following action at this meeting: 1.Bright Road Reserve 24-135Z-PDP Rezoning/Preliminary Development Plan Proposal: Rezoning 14.2-acre from R-1, Restricted Suburban Residential District to a Planned Unit Development District (PUD). Location: North of the intersection of Grandee Cliffs Drive and Bright Road. Request: Review and recommendation of approval of rezoning a 14.2-acre site from R-1, Restricted Suburban Residential District to PUD, Planned Unit Development District, and a Preliminary Development Plan for the construction of 20 single-family estate lots and associated site improvements. Applicant: Bill Adams Planning Contact: Rati Singh, Assoc. AIA, Planner I Contact Information: 614.410.4533, rsingh@dublin.oh.us Case Information: www.dublinohiousa.gov/pzc/24-135 MOTION: Mr. Way moved, Mr. Alexander seconded to recommend to City Council approval of the Rezoning and Preliminary Development Plan with 9 conditions: 1)The applicant provide a connected shared use path in Reserve A, per the City’s maintenance standards and revise the development text as required, prior to City Council submittal. 2)The applicant make adjustments to Lot 2, Lot 5 and Lot 13 to provide a minimum lot width of 40 feet to achieve more flexibility in driveway location and provide landscaping opportunities for a cohesive residential appearance and revise the development text to require the minimum lot width of 40 feet, prior to City Council submittal. 3)The applicant provide a uniform tree lawn within the entire development without any discrepancies between the drawings prior to City Council submittal. 4)The applicant revise the development text to address the discrepancies between the rear yard setbacks, primary structure setback and minimum private open spaces on Lots 1-10 prior to City Council submittal. 5200 Emerald Parkway Dublin, Ohio 43017 Community Planning and Development Sustainable | Connected | Resilient 614.410.4600 dublinohiousa.gov 5) The applicant revise the development text to require minimum side yard dimension of 6 feet on one side and 14 feet total prior to City Council submittal. 6) The applicant revise the development text to provide minimum setbacks for the front-loaded and side-loaded garages, prior to City Council submittal. 7) The applicant revise the development text to address lots along Bright Road, prior to City Council submittal. 8) The applicant show conceptual building envelopes with the submittal of the Final Development Plan. 9) The applicant remove redundant development requirements that match the requirements of the Zoning Code, prior to City Council submittal. VOTE: 7-0 RESULT: The rezoning and Preliminary Development Plan were recommended for approval and forwarded to City Council. VOTE: Rebecca Call Yes Kim Way Yes Kathy Harter Yes Jamey Chinnock Yes Gary Alexander Yes Jason Deschler Yes Dan Garvin Yes STAFF CERTIFICATION Rati Singh, Assoc. AIA Planner I MEETING MINUTES Planning & Zoning Commission Thursday, February 6, 2025 CALL TO ORDER Chair Call called the meeting to order at 6:30 p.m. in Council Chamber and welcomed everyone to the February 6, 2025 Planning and Zoning Commission meeting. She stated that the meeting also could be accessed at the City’s website. Public comments on the cases were welcome from meeting attendees and from those viewing at the City’s website. PLEDGE OF ALLEGIANCE Ms. Call led the Pledge of Allegiance. ROLL CALL Commission members present: Rebecca Call, Jason Deschler, Kathy Harter, Dan Garvin, Jamey Chinnock, Kim Way, Gary Alexander Staff members present: Thaddeus Boggs, Bassem Bitar, Rati Singh, Josh Reinicke, Zach Hounshell ACCEPTANCE OF MEETING DOCUMENTS Mr. Way moved, Mr. Garvin seconded acceptance of the documents into the record and approval of the 01-23-25 meeting minutes. Vote: Mr. Chinnock, yes; Mr. Way, yes; Ms. Harter, yes; Ms. Call, yes; Mr. Alexander, yes; Mr. Garvin, yes; Mr. Deschler, yes. [Motion carried 7-0.] Ms. Call stated that the Planning and Zoning Commission (PZC) is an advisory board to City Council when rezoning and platting of property are under consideration. In such cases, City Council will receive recommendations from the Commission and make the decision. In other cases, the Commission has the final decision-making responsibility. The Rules and Regulations of the Planning and Zoning Commission state that no new agenda items are to be introduced after 10:30 p.m. Anyone who intends to address the Commission on administrative cases must be sworn in. Ms. Call explained the hearing process that would be followed. Ms. Call swore in staff and audience members who anticipated providing testimony. CASE REVIEW Case #24-135Z-PDP Bright Road Reserve - Rezoning/Preliminary Development Plan Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 2 of 16 Request for review and recommendation of approval of rezoning a 14.2-acre site from R-1, Restricted Suburban Residential District to PUD, Planned Unit Development District, and a Preliminary Development Plan for the construction of 20 single-family estate lots and associated site improvements. The site is located north of the intersection of Grandee Cliffs Drive and Bright Road. and Case #24-151PP Bright Road Reserve - Preliminary Plat Request for review and recommendation of approval of a Preliminary Plat for 20 single-family lots. The 14.2 acre site is zoned R-1, Restricted Suburban Residential District, and is located north of the intersection of Bright Road and Grandee Cliffs Drive. As they pertain to the same project and property, Case #24-135Z-PDP and Case#24-151PP will be presented and considered together. Applicant Presentation Bill Adams, Managing Member, 4338 Bright Road Partners, LLC, 8824 Dunning Drive, Dublin, stated that also present this evening is the landowner, legal counsel, engineering consultant, land planning and architectural consultant, and the builder, Corinthian Fine Homes. Mr. Adams stated that the inspiration for this project is Session Village in Bexley, Ohio, which began development in the 1920s. It represents one of the most intimate and architecturally controlled small developments in Columbus, Ohio. While this is a unique project for Dublin, it showcases very sensitive land planning, controlled architecture, along with an elevated price point for the executive housing market. They are seeking a recommendation for approval with conditions to move forward to City Council. Brian Kinzelman, Senior Principal, MKSK, 462 Ludlow Alley, Columbus, stated that the inspiration for this development is an intimate hamlet of high-end single-family residences. This is not a gated community but they will be big homes on smaller lots with a collection of beautiful open spaces. The open spaces are virtually undevelopable due to major water courses, but they provide great character to the neighbors and neighborhood. This project will not negatively affect the existing character of Bright Road. The streetscape character internal to this site is one of intimacy. The homes will be close to the street with a well-tailored public realm and a compact streetscape. The development has a wood lot on the west and Billingsley Run on the east. One of those will be used for stormwater management. An illustration of the site was displayed. There is one access on Bright Road where the current driveway is, across from Grandee Cliffs. There are interior plantings from the previous home as well as existing screen plantings along Bright Road (Norway Spruce). The north property line is all volunteer growth. Those screening areas will need bolstered for health of the wood lot. There is a significant 20-foot landscape easement on the north and south property lines for the preservation of those fence rows. The intent is to augment those fence rows to ensure there are multiple generations of plant growth in those areas. There are reserves on the east and west and a central court, which is accessible public open space for neighborhood use. The central court is connected to the west wood through a casual walkway. The applicant’s preferred street section has a five-foot wide sidewalk on one side of the street with ADA compliant driveway aprons and connecting walkways at strategic places allowing everyone to have access to every home, Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 3 of 16 mailbox and the Bright Road entrance. The homes are being brought up to the streetscape with 15-feet setbacks and a 5-foot build-to line. The Dublin standard is six-foot sidewalks on both sides of the street. This would increase the right-of-way and push homes away from the street. This site has a small population and is not connected to other neighborhoods. The requirement for that level of pedestrian passage is too much. The Dublin standard would decrease the greenspace that is the central court and shorten the lots along the north edge of the property. Mr. Kinzelman addressed open spaces. The west wood is where they intend to hold stormwater. The east boundary (Billingsley Run) is staying as is with two watercourses passing through it and a culvert under Bright Road. Reserve C is the central gathering place for residents. There are also preservation areas around the boundary landscape. They are trying to be judicious with existing trees but will need to remove some to provide for stormwater management in the west wood. They will follow Dublin’s guidelines for tree replacement. The plan calls for a mix of hardwoods for street tree plantings. They will augment fence rows and wood lots. Mr. Kinzelman stated that the utilities are simple thanks to their civil engineers. There is drainage in the backyards of interior lots going to the basin to the west. A portion of the site is being drained directly into Billingsley Run, but they are overcompensating for that from a stormwater management standpoint on the west. It will net no change downstream. Mr. Kinzelman stated that the central court has been made public use. It will be a passive activity lawn and will be tastefully planted along the perimeter. Lots two and four have been pulled apart to allow a central spine through the middle of those. That is being called a casual specialty paved walk. It is a pedestrian path to get residents down to and into the wooded lot. In the wood lot is a space akin to a residential patio in scale, giving residents and neighbors a chance to enjoy the wood lot without walking through it. The stormwater basin will be surgically graded. They will try to grade this to miss significant trees. The bottom of the basin will be landscaped with the approval of engineering so that it does not need to look like a commercial detention basin. The goal is to not recognize it as stormwater management. Staff has asked for a paved ten-foot path to the discharge device. There is no paved circulation through the west wood. Staff has asked that the stormwater basin be dedicated to the City of Dublin and the City will maintain that. Billingsley Run is considered to be deeded to Dublin for maintenance. The central court and east court will be owned by Dublin but maintained by the homeowners’ association (HOA). Landscape easements will be privately held. Taylor Dennis, The Jones Studio, 503 City Park Avenue, Columbus, stated that Brian Jones could not attend this evening but wanted to express his enthusiasm for the project. The Jones Studio was hired to set the architectural vocabulary for the project. They are showing midwestern vernacular architecture with European country to align with the context of Dublin’s architecture and to show the European hamlet style. The focus is on three main categories: massing, fenestration and materiality. The forms will be kept simple with one and a half to two story houses. They would like to keep consistent roof pitches but bring in a mix of hip and gable roofs to provide some variety. Regarding fenestration, they will keep proportional light cuts, proportional sizing, and consistent patterns throughout. Brick, stucco and stone will be the primary materials. They intend to keep a consistent palette throughout while giving each home some variety. Images showing character, size, scale and materiality were shared. Staff Presentation Ms. Singh stated that the application before the Commission tonight is a combined Rezoning, Preliminary Development Plan (PDP) and Preliminary Plat. PDP/rezoning is a second step in a three- Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 4 of 16 step process for a Planned Unit Development (PUD) and is heard by both Planning and Zoning Commission and City Council. Considerations for the Commission are land use and densities, general site layout, streets and circulation, open space framework and integration with the surrounding areas. Recommendation to City Council is requested. The platting process is required for any new subdivision and considerations are lot sizes, open space size, and street and easement locations. The site is a combination of two parcels and is zoned R1, Restricted Suburban Residential, and is surrounded by residential developments. Hopewell Elementary School is located across Bright Road towards the southeast and Ferris-Wright Park to the southwest across Bright Road. Bright Road has a rural character with no curbs, a ditch, trees, and homes with large setbacks from the road. It is a cul-de-sac and a low traffic volume road. The Community Plan Future Land Use recommends residential, low-density and envisions large lot residential developments that consider environmentally sensitive areas and integrate the existing natural features within the development. The goal is to create a transition from a rural setting to suburban single-family neighborhoods. The principal uses that are permitted are single-family homes on half-acre lots with a permanent density of 0.5 to 2 development units per acre. The density for this proposal is 1.4 development units per acre. A traffic impact analysis was provided by the applicant highlighting traffic impacts of the development on the surrounding roadway network and identifying any mitigation measures necessary. There is no eastbound traffic expected, and hence no dedicated left turn is required. A small amount of traffic is generated on Bright Road and per the analysis, the traffic volumes do not meet the minimums for advancing traffic on Ohio Department of Transportation right turn lane warrants so no right turn lane is required. Based on the Mount Carmel and Beacon traffic impact studies, the Bright Road and Emerald Parkway intersection operates at an acceptable level of service. The Bikeway Plan recommends a shared use trail along the south side of Bright Road. The City is currently working on extending the shared use path. The path will cross Billingsley Creek and terminate at Grandee Cliffs Drive. Envision Dublin recommends that pedestrian and bike facilities be included on both sides of the road. Given the rural character of Bright Road, staff is satisfied with one shared use path. To ensure connectivity to the future shared use path, two crosswalks are proposed by the developer. One at the intersection of Bright Road and Grandee Cliffs Drive and the other at the southwest corner of the site across from Ferris-Wright Park. The applicant will coordinate with staff regarding timing of these pedestrian crossings. In 2004, City Council amended a resolution that established guidelines for Conservation Design Development. The purpose and intent of these guidelines is to create visually appealing and vibrant neighborhoods, while safeguarding the environmentally sensitive areas. This is achieved by promoting sensitive site planning and allowing deviations from standard development regulations as well as conventional subdivision regulations. The most prominent natural features present on the site include Billingsley Creek, the west wood area, and the trees along the north and south of the property. It was acknowledged at the Concept Plan step that the proposal meets the conservation design resolution. The City adopted Neighborhood Design Guidelines (NDG) in 2023 to ensure that the residential PUDs achieve the expectations outlined by the Code and produce more creative and sustainable Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 5 of 16 neighborhoods. The NDG only considered a dry stormwater detention facility as a contributing open space when the area achieves a superior and interactive design as usable open space. The proposal shows pedestrian paths to the stormwater facility. However, additional interventions are required to ensure that the west wood is a usable space. The development text notes a five-foot tree lawn as a standard throughout the development, but the drawings indicated a 5.5’ wide tree lawn, which further narrows. The Code requires a minimum of five-foot tree lawn and Envision Dublin recommends an eight-foot tree lawn. The applicant must ensure that the uniform tree lawn is noted in the development text and aligns with the drawings. Minimum setbacks should be included in the development text for the side-loaded garages. The NDG recommend that the side yard must be six feet on one side and a total of fourteen feet for lots one through ten. Based on the information provided, the minimum depth of the private open space is not accurate and there are inconsistencies in the numerical standards. Revisions to the development text will be required. The proposed development is an infill project, which is surrounded by single-family residential neighborhoods and is only accessed via Bright Road. No additional road connections are planned for this development. To facilitate maintenance of the detention basin, a ten-foot-wide shared use path is proposed from the southwest corner, which leads to the detention basin. The developer is proposing an eight-foot-wide specialty paved path from the central court to the detention basin. Staff recommends a continuous shared use path from Bright Road to the neighborhood, ensuring pedestrian connectivity throughout the proposed development from the southwest portion of the site connecting through the neighborhood. The proposed street will be public with a 50-foot right of way extending from Bright Road to the first intersection. The remainder of the street will be 40 feet wide. While the City recommends a 60-foot right of way, subdivision regulations require 50 feet. Five-foot sidewalks are proposed along the eastern side of the street. Recently adopted City standards require a six-foot sidewalk on both sides of the street with any development. Staff has requested that the applicant provide factual details and implications of providing these sidewalks on both sides of the street and its impact on the proposed development. The applicant provided a cross section; however, no drawings were presented to staff to determine if the sidewalk would impact the development standards and the proposed layout. Lots 2, 5, 10 and 13 are the inside corner lots with a narrow width varying from 29 to 43 feet. Staff recommends a minimum of 40 feet for each lot with to ensure that there are enough landscaping opportunities in the front. Ms. Singh shared the PDP and Preliminary Plat Criteria. Staff recommends a recommendation to City Council for approval of the rezoning and PDP with the following Conditions: 1) The applicant provide a 6-foot wide sidewalk on both sides of streets in the subdivision and revise the development text accordingly, prior to City Council submittal. 2) The applicant provide a connected shared use path in Reserve A, per the City’s maintenance standards and revise the development text as required, prior to City Council submittal. 3) The applicant make adjustments to Lot 2, Lot 5 and Lot 13 to provide a minimum lot width of 40 feet to achieve more flexibility in driveway location and provide landscaping opportunities for a cohesive residential appearance and revise the development text to require the minimum lot width of 40 feet, prior to City Council submittal. 4) The applicant provide a uniform tree lawn within the entire development without any discrepancies between the drawings prior to City Council submittal. 5) The applicant revise the development text to address the discrepancies between the rear yard setbacks, primary structure setback and minimum private open spaces on Lots 1-10 prior to City Council submittal. Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 6 of 16 6) The applicant revise the development text to require minimum side yard dimension as 6 feet on one side and 14 feet total prior to City Council submittal. 7) The applicant revise the development text to provide minimum setbacks for the front-loaded and side-loaded garages, prior to City Council submittal. Staff recommends a recommendation of approval of the Preliminary Plat with the following conditions: 1) The applicant ensure that the site survey, easements, grading, and engineering comments are shown on the plat prior to City Council submittal, and 2) The applicant address any other technical adjustments as needed. Commission Questions Mr. Garvin stated that the updated proposal does not show a connection through the detention basin. He asked if there is a way to put a path through there. Mr. Kinzelman stated that it can be done but it will cost trees and will change the character of the west wood. He respectfully disagrees that the requested maintenance path needs to be ten feet wide and asphalt-paved for periodic maintenance. There is also concern that that will invite people to think it is a bike path. Engineering has also asked them to put in a painted crosswalk across Bright Road. The maintenance path is not meant to encourage pedestrian traffic. The connecting path from the central court is more of a garden path to allow people to enter the woods without going through it. They have neighbors at Hannah Woods and to the west where that west wood is in the backyards of their lots. This should be a passive wood lot not open to any recreation. Mr. Garvin asked how it would be accessed by neighbors. Mr. Kinzelman stated that the central court is their community’s living room. There is a sidewalk on Bright Road and that is the way people will enter and exit this development. There are no walkway connections with the other neighborhoods. They would suggest to those that want to enjoy those woods, to do so passively and enter through the interior of the site. It is a reserve and not a public park. Mr. Garvin asked if the City has any plans to make the gravel pathway at Ferris Wright Park part of the shared use path. Ms. Singh stated that she is unaware of any plans for the path within the park but the City does have plans for the shared use path which extends to the end of Bright Road. Mr. Chinnock asked how the residents of this neighborhood will get to Ferris Wright Park if they do not take that path. Mr. Kinzelman stated that residents can go down their sidewalk along Road A and across Bright Road at a crosswalk. Mr. Garvin asked what the difference would be to the project between five feet and six feet of sidewalk on one side. Mr. Kinzelman stated that they originally planned a single four-foot sidewalk but after conversations with staff, they bolstered that to five feet. They wanted to do a four-foot brick path. Five feet would have to be concrete. Six feet of sidewalk on both sides requires 40 feet of right of way and will cost open space on the court and developable space to the north. There is not much developable ground to begin with, every foot counts. The character of the streetscape is important and six-foot sidewalks call for way too much concrete for a development of 20 single-family residences. This is why they are proposing a PUD – so they can set the standards and the Commission can adjudicate them. Mr. Garvin asked if roads are expected to be asphalt. Mr. Kinzelman answered affirmatively. Detailed conversations with City Engineering staff will happen at the time of Final Development Plan. This is an enclave and not a subdivision. Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 7 of 16 Mr. Garvin asked about staff’s recommended conditions. Mr. Kinzelman stated that there are three of them that they do not want. The six-foot sidewalks condition is one. They do not want a trail through the west wood. That is a reserve and not a park. The other condition they do not agree with is the 14-foot side yard requirement. They increased side yard setbacks to six feet from five. For custom homes, the 14 feet starts to restrict the lots. Many of the lots have topographical considerations. Mr. Deschler asked for more information on the masonry piers and uplighting mentioned in the applicants’ narrative. Mr. Kinzelman stated that the intent is to set the tone with the public domain. That is part of the landscape plan and will give a sense of place. Along Street A off of Bright Road, there may be a series of masonry piers to give intimacy and put architecture on the street. At the terminus of Street A, that view may have some masonry element. The idea is for a streetscape ornament with a strong connection to architecture. Mr. Deschler asked if there will be an entry feature. Mr. Kinzelman stated that the character of Bright Road is attractive now. There is an existing board rail fence underneath a canopy of Norway Spruce. A tasteful street sign is as bold as they want to go. They are looking to fit into the neighborhood, not be an exclusive place on Bright Road. Mr. Deschler asked for information on ownership of Reserve C and D by the City of Dublin. Mr. Kinzelman stated it is the applicant’s preference for the HOA to own and maintain them. It was suggested by staff to be City owned since it is surrounded by public right of way. Mr. Deschler asked for input from the City. Ms. Singh stated that since it is classified as a reserve, it was considered that it be owned by the City but it is a continued discussion between the City and the applicant. Ms. Call stated that this will go before City Council as well. Mr. Way stated that the architectural plan shows a gatehouse. Mr. Kinzelman stated there was original consideration of a proverbial guard house, but it was determined to be too bold in later analyses. The design of the two homes on lots 1 and 20 need to address that intersection and create an entrance feel without doing a subdivision sign wall. Ms. Call quoted the development text, “No entry feature is anticipated as part of this development in an effort to create a seamless physical and practical connection to the surrounding neighborhood.” Mr. Deschler asked if the homes with no sidewalks will have a walk to the curb. Mr. Kinzelman stated that they will have an entrance walk from their driveway or auto court to their front door. They will have access down their driveway. If the sidewalk is on the other side of the street, they have walkways planned that allow people to cross the street and be on the sidewalk. They anticipate very little pedestrian or vehicular traffic. Mr. Deschler referenced the access road and asked how many times per year the City would have to access the site. Mr. Reinicke stated that the City has a bare minimum requirement of inspections on all detention basins in the City of once per year. Given the dry nature of the pond, the need for maintenance will be higher. The outlet structure will be more likely to clog with debris from vegetation. That would be accessed multiple times per year. The time that maintenance is typically required is right after it has rained. If maintenance vehicles need to access the site and the path is not paved, the ground could be wet and there is a significant chance they would rut the ground. There is also the drainage swale that the detention basin is discharging into that will need some sort of culverted path to get across it. With the nature of maintenance vehicles that might need to get back there, the idea of having anything other than a hard surface is not ideal. Mr. Deschler stated that a paved path would provide an additional route for bicyclists or a car. He asked what kind of safety measures would be put in place to Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 8 of 16 prevent others from using the access. Mr. Reinicke stated that those are ongoing discussions between staff and the applicant. Mr. Deschler asked if there is any other option than asphalt. Mr. Reinicke stated that staff is recommending asphalt as the surface. City Parks and Recreation staff will also be maintaining the reserve and their preference is also to have asphalt. Mr. Deschler asked about the width. Mr. Reinicke stated that the width is necessary to get a maintenance vehicle back there. Maintenance vehicles can vary in size based on the maintenance needs. Ms. Call asked if the City is requesting anything of this development that they would not ask of any other development. Mr. Reinicke answered that they are not. Mr. Deschler asked the applicant if they had ideas for alternate materials for the paved path. Mr. Kinzelman stated that they have proposed to surgically align a path through the trees. They propose to compact the subgrade and put in a 304 aggregate base course of sufficient width and of sufficient structural integrity to hold a vehicle and grade it such that it drains appropriately. They will also put in the culvert pipe, extend its ends and put the paved aggregate surface over the top of it. That provides the same level of vehicle access and does not look like a multi-use trail. It would not invite cyclists or motor vehicles to go back into the space. Mr. Reinicke stated that additional discussion could be had. Mr. Kinzelman stated that engineering has been helpful and collaborative and he looks forward to continued discussion. Mr. Deschler asked for clarification on staff’s recommendations regarding the frontage width on lots 2, 5, 10 and 13. Ms. Singh stated that they are all inside corner lots. Lot 10 (43 feet) is of an acceptable width. Staff is recommending they be at least 40 feet in width to allow for flexibility for landscaping features. Mr. Kinzelman stated that they are willing to alter lot lines but it is not necessary. The design is prescriptive as to where the driveway comes in. The width will not provide more flexibility with driveway locations. It will make no practical difference. Mr. Alexander stated that the lot width requirement is so that the houses can face the street. Ms. Singh confirmed that is correct and that it allows for consistent frontage. Mr. Alexander stated that the six-foot sidewalk width requirement is to facilitate clear passage of two people. He asked if the City evaluates Code based on the size and scale of a particular development. Mr. Bitar stated that it is a standard for all developments. Mr. Alexander asked if staff is willing to reduce the tree lawn as long as it is consistent throughout the development. Ms. Singh stated that the Code requires a five-foot tree lawn width, even though Envision Dublin recommends eight feet. Staff is comfortable with five feet as long as it is consistent throughout. Mr. Alexander stated that an earlier proposal showed a path from the cul-de-sac into the reserve to the east. He asked if that is still contemplated. Mr. Kinzelman stated that at one time, there was thought of having soft surface paths matching the dirt paths that people have created in those woods. However, they did not want to encourage that because those areas are people’s backyards. Mr. Alexander asked for more details regarding the central court. Mr. Kinzelman stated that will be usable public open space. They thought it was important to give those lots that touch the central court the luxury of having that green space in their front yards. That design will continue to be fine-tuned as the project progresses. Mr. Alexander asked for more details regarding the end of the terminus. Mr. Kinzelman stated that because they do not need that interior circumference, they wanted to create some small garden. It is not useable but ornamental space with indigenous plants. Mr. Way asked for the status on the buffer to the north. Mr. Kinzelman stated that they met with neighbors north of lot 10 and would be happy to meet again when they get to planting detail. Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 9 of 16 There are some holes in that fencerow. The applicant intends to plant indigenous material. They want to satisfy the neighbors. Mr. Way asked about the floodplain as identified on the drawings near the cul-de-sac. Mr. Kinzelman stated that the cul-de-sac is not in the floodplain. Mr. Reinicke stated that the 500- year floodplain may be shown. FEMA does designate a 100- and 500-year floodplain. Ms. Call requested that be clarified at the next review phase. Mr. Way asked if there is any kind of riparian edge requirements along the stream. Mr. Kinzelman stated that they have spoken with engineering and there will be some erosion protection as they discharge into that creek. It is a swale with not much definition. Billingsley Run as it crosses under the bridge and goes south is a true creek bed. Mr. Way asked about vegetation in the detention basin. Mr. Kinzelman stated that it is not a wetland. The basin will drain. They have the opportunity to sculpt the edge horizontally and vertically and vegetate the bottom. Plants will need to withstand wet conditions and very dry conditions. They want to put in some canopy to provide shade as it is now and also use middle and low scale shrub plantings and ornamental trees. Ms. Harter sought confirmation that the City will be in charge of maintaining the basin. Ms. Singh answered in the affirmative. Ms. Harter asked about the maintenance of brick sidewalks. Ms. Singh stated that will be discussed prior to Final Development Plan review. Ms. Harter asked if City maintains brick sidewalks anywhere else. Ms. Singh stated that the City maintains brick sidewalks in Historic Dublin. Mr. Chinnock asked about the thought behind the lack of connection to the community and the exclusivity of the development. Mr. Kinzelman stated that the fact that this is an infill site that is wooded on the perimeter makes it inherently exclusive. This development will have a low population. Anyone that has a bike or scooter is likely going to use the street because there will be very little vehicular traffic. A bike trail will go on the south side of Bright Road someday and they are committed to providing crosswalks to get to the future trail. The wood lot is in people’s backyards and they do not want to put circulation in people’s backyards. There is precedent for non-activated reserves in Dublin. Mr. Chinnock asked if the architecture fits in with the Bright Road character. Mr. Kinzelman stated that this is a multi-generational neighborhood. There is some 1960s housing stock, 1980s and 1990s housing stock. There is no prevailing architectural style in this district. This development will be the next generation. Whatever they do will be high quality. It is meant to blend in and complement the neighborhood. Mr. Chinnock asked the applicant to provide a sense of scale. Mr. Kinzelman stated that the smallest lot within the restrictions of the setbacks, is laid out with a three-car garage, required open space and a 5,000 square foot home. Some lots are more modest than others. On the other larger lots, some homes may sit back from the roadway and will be large. The homes are truly custom. There are no prescriptive homes for these lots. Ms. Call stated that a ]PUD has a different approach. She asked staff to explain at what stage the Commission is recommending adoption of a development text. Ms. Singh stated that the development text is finalized at this step as long as the listed conditions are met. There will be no additional changes at the Final Development Plan stage. Ms. Call stated that the opening statement of the development text states, “Where conflict occurs between the City of Dublin Code and these development standards, the development standards Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 10 of 16 shall apply and supersede the Code.” She asked if this means that when there is a conflict between the Code and the text, that the development text supersedes. Mr. Boggs answered affirmatively and stated that where there are items on which the text is silent, Code comes in and fills in the gap. Ms. Call asked to what degree the Planning and Zoning Commission ought to verbalize any concerns with the development text at this PDP phase. Ms. Singh stated that if the development text does not align with the NDG, now is the point to address it. Ms. Call asked if accessory dwelling units (ADUs) are permitted in the City of Dublin. The development text is not clear on ADUs. She asked if the applicant envisions ADUs as part of the development. Mr. Kinzelman stated that he does not. Mr. Boggs stated that there are zoning districts where ADUs are contemplated as conditional uses – the Bridge Street District and the Historic District. Ms. Call asked if the applicant would be willing to remove language from the text where the Code already accomplishes the same thing. Mr. Kinzelman stated that they would be willing to remove duplicate language on a case by case basis. They have no intent to slip something by the City. Ms. Call asked how the applicant would accomplish allowing parking on one side of the street. Mr. Kinzelman stated that they would work with engineering staff on that but it may be as simple as signage indicating no parking on the south side of the street. This is a small community with small streets but there is sufficient off-street parking. Ms. Call asked if the City allows thin brick in residential neighborhoods without a PUD. Ms. Singh stated that she does not believe so. Ms. Call asked if there is a standard for the garage plane. Mr. Kinzelman stated that they have had many conversations with staff and they are happy to work with staff to get clarity and add that to the text. In response to staff’s conditions of approval, Mr. Kinzelman stated that they are looking to the Commission to adjudicate conditions #1, #2 and #6. They will work with staff on the remainder. Mr. Deschler asked staff to elaborate on Condition #5. “The applicant revise the development text to address the discrepancies between the rear yard setbacks, primary structure setback and minimum private open spaces on Lots 1-10 prior to City Council submittal.” Ms. Singh stated that the development text lists the rear yard setbacks, the primary structure setbacks, and the minimum private open spaces. Currently, the mathematical calculations are not accurate. Mr. Kinzelman stated that they have been emailing with staff about it and need to work it out with a map. Public Comment John Rahm, 4273 Hannah Hills Drive, Dublin, stated that they have been in contact with the developer who was very amiable and took into consideration items with which they had issues. Their neighborhood does not have sidewalks at all. They all like having no sidewalks. It is a tight community because of this. He is against a requirement for more concrete. The entrance into Ferris Wright Park is a stone driveway. They are looking forward to new neighbors. The area is starting to see new builds and remodels. It is not cookie cutter. He closed by thanking the Commission for their time. Lauren Ranalli, 4760 Bright Road, Dublin, stated that she lives west of the proposed development and she disagrees with the comment about sidewalks. She has a one-year-old and walks Bright Road and it would be nice to have more safe paths to walk on. She does not feel strongly about Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 11 of 16 both sides of the street but it would be nice to have somewhere safe to go. Limiting this too greatly would be a disservice, especially with the elementary school nearby. There are way more kids on bikes on Bright Right and there is nowhere for them to go. The ess curve just past this neighborhood is very dangerous. She has encountered the cross country team on the street and they take up the entire width. She is in favor of more safe, distinguished walking paths. Commission Discussion The Commission discussed the City’s recommended conditions of approval. 1) The applicant provide a 6-foot wide sidewalk on both sides of streets in the subdivision and revise the development text accordingly, prior to City Council submittal. 2) The applicant provide a connected shared use path in Reserve A, per the City’s maintenance standards and revise the development text as required, prior to City Council submittal. 3) The applicant make adjustments to Lot 2, Lot 5 and Lot 13 to provide a minimum lot width of 40 feet to achieve more flexibility in driveway location and provide landscaping opportunities for a cohesive residential appearance and revise the development text to require the minimum lot width of 40 feet, prior to City Council submittal. 4) The applicant provide a uniform tree lawn within the entire development without any discrepancies between the drawings prior to City Council submittal. 5) The applicant revise the development text to address the discrepancies between the rear yard setbacks, primary structure setback and minimum private open spaces on Lots 1-10 prior to City Council submittal. 6) The applicant revise the development text to require minimum side yard dimension as 6 feet on one side and 14 feet total prior to City Council submittal. 7) The applicant revise the development text to provide minimum setbacks for the front-loaded and side-loaded garages, prior to City Council submittal. Mr. Alexander agreed with the applicant that six-foot sidewalks on two sides does not make sense with the size of this development and the size of the streets. He is comfortable with five feet as proposed. He is ambivalent on Condition #2. He thinks Condition #3 is very important. This development is similar to but different than Sessions in that this must be rationalized to a Code. Being able to have homes front on the street and define the public realm is important. His preference would be to keep Condition #6 because it is consistent with other Codes and there is a logical benefit. Mr. Deschler stated that he would like Reserves C and D owned and maintained by the HOA. He agreed with Mr. Alexander on Condition #1 and added that sidewalks should be four feet and be paver or brick. Based on this community, he feels it would be appropriate with no sidewalks. He does not agree with Condition #2. He does not believe there should be a continuous path from Bright Road. He is supportive of the applicant’s position on Condition #3. He would like to see differentiation with the lot sizes and allocation of the homes. He does not believe there is a need for Condition #6. Mr. Garvin stated that the sidewalk is not necessary on both sides. He is more supportive of brick or paver and a width of at least five feet. He does support staff’s position that there should be a shared mixed-use path to connect those two other paths. A great feature of Dublin is that as neighborhoods are developed there is the addition of puzzle pieces to this network of paths. He is ambivalent regarding Condition #3. Conditions #4 and #5 should stay. Regarding Condition Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 12 of 16 #6, he does not see the need for the additional foot on either side. He would like to see Condition #7 stay. Mr. Garvin added that connecting the paths adds value to Ferris Wright Park. If there is a solution to support vehicles that is not asphalt, he would be supportive of that. Mr. Chinnock complimented the development. He referenced Conditions #1, #2, and #6. He does not think the size of this development warrants that much sidewalk. He agrees with four or five feet and on only one side of the street. Connectivity is very important in this community, and he does not see how we do not require a path that connects. He would be supportive if an alternative material could be determined to meet engineering’s standards. The path needs to connect to the community. In the spirit of Dublin, we need paths that connect and support the community. He agrees with staff on #6. There is a reason there is a minimum. Ms. Harter appreciates the applicant working with the community. She agrees that Condition #1 is not necessary. She is in support of staff’s position on the rest. She asked for details on the mailboxes when this comes back before the Commission. Mr. Way stated this is a special and unique development and he is supportive of it as a concept. The fact that it follows the City’s Conservation and Neighborhood Design Guidelines is commendable. The woodland preserves are something that makes this unique and he supports the notion of preserving those as much as possible. They are wooded and private and not something to invite the public into. In this particular case, he does not think the path mentioned by Condition #2 needs to connect all the way through. He would like to see the material of the maintenance drive be something that is more natural and still meet the requirements of the City. This is a development where he sees the need to be very careful with how much we mess with nature. Mr. Way stated that the Commission’s responsibility is to follow the City’s codes and standards. This is a unique enough development and it goes above and beyond with conservation, design and low density to consider not making it look like every other subdivision in Dublin. He was a proponent of six-foot sidewalk on both sides of the street as they worked on the Community Plan, however, in this particular development, he is open to the sidewalk being on one side of the street. He does have an issue wrapping it around Reserve C. He would rather see the sidewalk wrap around the edge and tie into the other one. Brick would be great. Mr. Way stated that this will be unique enough that the 40-foot lot standard can be overlooked. The conformity of the tree lawns is important. He would like to keep the 14-foot side yard requirement. Mr. Way stated that he would like to add a condition for the Commission to consider. Lots 1, 2, 13, and 20 relate uniquely to Bright Road. He would like see the applicant do more formal four- sided architecture on Bright Road. He would like to see language about the lots fronting onto Bright Road having a positive relationship. Ms. Call stated that PZC considers applications in isolation as well as what they could be. There are many areas in the City undergoing redevelopment. This current application is great, but it may at some point become part of larger redevelopment. They have to consider future implications of current decisions. There are reasons for a six-foot sidewalk requirement and the side yard setback requirement. The standards are compounding and contribute to the public feel. She is willing to consider a six-foot sidewalk on one side of the street. She supports staff’s position of the 14-foot side yard setbacks. The City has to maintain the detention basin so we need to provide employees with tools to do their job. Ms. Call expressed appreciation for the diligence and thoughtfulness that went into the plan. There are opportunities for clarification with Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 13 of 16 the next phase. She suggested a visual representation of the building envelope be provided at the next step. She is not in favor of thin brick as an approved material. She is ambivalent on ownership of the reserves and will defer to the City. The development text becomes the code for the site, so we want to make sure we get that right. There is some duplicate development text (pages 10, 13, 18 and 19). She referenced page 13 regarding crosswalks and suggested language be added on timing and location or remove the reference. Because the development text relates to the conditions, it will need to be amended to match. She is willing to sacrifice one side of the sidewalk but that affects the right of way and that will need to be reflected in the build envelope. PUDs are a give and take. There is higher quality in one area for sacrifice in another area. Ms. Call summarized the list of additional conditions for consideration as follows: • The development text address homes adjacent to Bright Road (4 lots). • Removal of redundant Code items from Development Text. • Removal of thin brick as a permitted material. • Visual build zone translation at next phase. • Removal or clarification of subjective items from development text. Commission consensus was to remove Condition #1. Regarding sidewalk materials, Mr. Hounshell stated that because this is a public sidewalk, it will have to be maintained to a public standard. Planning and Engineering staff will work together and take the Commission’s comments into consideration. With no objection from the Commission, the meeting was adjourned for a brief recess. Ms. Call reconvened the meeting at 9:21 will all members returning to the dais. Mr. Kinzelman stated that Mr. Way mentioned the sidewalk around the perimeter of the central court and Ms. Harer mentioned the mailboxes. The mailboxes will be located on the south edge of the central court. That walkway is meant to gather people. Mr. Kinzelman stated that they would like leeway on thin brick as a permitted material. He has seen it used successfully as trim material on custom homes. Ms. Call asked if full brick would be feasible. Mr. Kinzelman stated that it depends on the wall section and construction methods. Mr. Alexander stated that another common use of thin brick is on non-masonry chimneys. It is not unusual in houses of this value. Ms. Call stated that it is not permitted in most of the City. To make an exception in such a unique and high-quality development seems contrary. Mr. Garvin stated that he would be in support of the requirements matching the non-PUD specifications. Mr. Hounshell stated that the residential appearance standards name brick as a permitted finish material but it does not distinguish between full depth and thin brick. Mr. Deschler expressed concern with vinyl being a permitted finish material. Mr. Kinzelman stated that lots 1 and 20 already have a relationship to each other because that is the corridor opening for the roadway. Lots 2 and 13 will likely not be visible from Bright Road with the existing Norway Spruce and augmented plantings. Ms. Call clarified that the text would just address those lots. If the text stated that there will be vegetative screening, then it would be compliant. Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 14 of 16 Mr. Kinzelman stated that they would like to have continued conversations with engineering staff regarding the shared use and the maintenance portion of that path. Mr. Way clarified that the development text does not commit the applicant to brick. Mr. Kinzelman stated that the dimension is important to them and the material can be decided upon later. Mr. Way moved, Mr. Alexander seconded to recommend to City Council approval of the Rezoning and Preliminary Development Plan with the following conditions: 1) The applicant provide a connected shared use path in Reserve A, per the City’s maintenance standards and revise the development text as required, prior to City Council submittal. 2) The applicant make adjustments to Lot 2, Lot 5 and Lot 13 to provide a minimum lot width of 40 feet to achieve more flexibility in driveway location and provide landscaping opportunities for a cohesive residential appearance and revise the development text to require the minimum lot width of 40 feet, prior to City Council submittal. 3) The applicant provide a uniform tree lawn within the entire development without any discrepancies between the drawings prior to City Council submittal. 4) The applicant revise the development text to address the discrepancies between the rear yard setbacks, primary structure setback and minimum private open spaces on Lots 1- 10 prior to City Council submittal. 5) The applicant revise the development text to require minimum side yard dimension of 6 feet on one side and 14 feet total prior to City Council submittal. 6) The applicant revise the development text to provide minimum setbacks for the front- loaded and side-loaded garages, prior to City Council submittal. 7) The applicant revise the development text to address lots along Bright Road (Lots 1,2,13 and 20) to be given extra attention and maintain relationship with Bright Road, prior to City Council submittal. 8) The applicant show conceptual building envelopes with the submittal of the Final Development Plan. 9) The applicant remove redundant development requirements that match the requirements of the Zoning Code, prior to City Council submittal. Vote: Ms. Harter, yes; Mr. Deschler, yes; Mr. Alexander, yes; Mr. Chinnock, yes; Ms. Call, yes; Mr. Way, yes; Mr. Garvin, yes. [Motion carried: 7-0] Mr. Deschler stated that he is in support of the project moving forward to City Council but he does not believe Conditions #2, #3, and #6 should be included. Mr. Deschler moved, Mr. Way seconded to recommend to City Council approval of the Preliminary Plat with the following conditions: 1) The applicant ensure that the site survey, easements, grading, and engineering comments are shown on the plat prior to City Council submittal. 2) The applicant address any other technical adjustment as needed. Planning and Zoning Commission Meeting Minutes – February 6, 2025 Page 15 of 16 Vote: Ms. Call, yes; Mr. Garvin, yes; Mr. Alexander, yes; Mr. Way, yes; Mr. Chinnock, yes; Mr. Deschler, yes; Ms. Harter, yes. [Motion carred: 7-0] Case #25-005ADMC - Code Amendments Review and recommendation of approval for Zoning Code Amendments to Sections 153.002, 153.048, 153.066, 153.176 regarding the Concept Plan review process, 153.037-153.042 and 153.236 regarding the West Innovation District, 153.158 regarding temporary signs for Special Events, and 153.076 regarding Property Nuisance regulations. Staff Presentation Mr. Hounshell stated that this was before the Commission in November of 2024. This request focuses on Concept Plans, the West Innovation District uses, and Temporary Signage. These amendments are being proposed in order to achieve the goals of the Economic Development Strategy, which is to make Dublin’s development processes more transparent and predictable. This is derived from feedback that has been received internally from different City departments as well as from development partners bringing projects forward. Staff initiated a development review process through which six major action items were identified. Tonight’s request focuses on the “Requirements and Review Process” action item. Staff has worked to determine how the Concept Plan works within the City. This proposed amendment went to the Architectural Review Board in January for recommendation because it does impact the Historic District. Currently, everywhere in the City except for the Bridge Street District, the Historic District, and the Mixed-Use Regional District, the Concept Plan is a required step with no determination. It operates like an Informal Review but is a required step. In the three districts named above, it is currently a determination. That has created some challenges in terms of consistency of the review process. The goals of this proposed amendment are to provide consistency, allow for an applicant to gain feedback without being locked in, and potentially cut out a step with the Informal Review. Staff is proposing to keep the Concept Plan a required step, but offer non-binding feedback. In applications where a recommendation to City Council is made, the Concept Plan will no longer go to City Council because they already review a development agreement. Mr. Hounshell stated that the next amendment involves the West Innovation District (WID). Planning staff has worked with economic development partners and kicked off a new strategic implementation plan. Through those efforts, staff is trying to identify barriers. Several users in contract for properties in the ID2 District have found that the Assembly and Manufacturing Use as conditional uses is a barrier in terms of Dublin’s competitiveness with other districts throughout Central Ohio. The purpose of this amendment is to make Assembly and Manufacturing permitted uses. It does not change the character and intent of this area but allows the City to achieve the goals of the Envision Dublin Plan. The only change would be to make Assembly and Manufacturing permitted uses in the ID2 District. No other districts are changing at this point. There is also an update to a definition for wholesale and distribution that will add clarity. Mr. Hounshell explained the amendments regarding Temporary Signs. This is specific to the City’s special events and community activities. It is to align with current practices. The definition of Special Events has been updated to provide clarity. Those permits go directly through Community Engagement team and Event staff. 5200 Emerald Parkway Dublin, Ohio 43017 Community Planning and Development Sustainable | Connected | Resilient 614.410.4600 dublinohiousa.gov PLANNING REPORT Planning and Zoning Commission Thursday, February 6, 2025 Bright Road Reserve 24-135Z-PDP & 24-151PP https://dublinohiousa.gov/pzc/24-135/ | https://dublinohiousa.gov/pzc/24-151/ Case Summary Address 4338 Bright Rd. & PID: 273-011149 Proposal Rezoning 14.2-acre from R-1, Restricted Suburban Residential District to a Planned Unit Development District (PUD) and a Preliminary Plat for 20 single- family lots and associated site improvements. Request Review and recommendation of Rezoning/Preliminary Developmen Plan (PDP), and Preliminary Plat (PP). Zoning R-1 – Restricted Suburban Residential District Planning Recommendation Recommendation to City Council of approval of a Rezoning and Preliminary Development Plan with Conditions Recommendation to City Council of approval of a Preliminary Plat with Conditions Next Steps Upon review and a recommendation of approval of the Rezoning, PDP and PP by the Planning and Zoning Commission (PZC), the applicant will be eligible to move forward with the request to City Council. Applicant Bill Adams Case Manager Rati Singh, Assoc. AIA, Planner I (614) 410-4533 rsingh@dublin.oh.us City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 2 of 17 Site Location Map 1 Wright Run (Billingsley Creek) 2 Existing asphalt entrance 3 West Wood 1 2 3 City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 3 of 17 Request and Process Request The applicant is requesting review and recommendation to City Council of approval of a Rezoning/Preliminary Development Plan (PDP) and a Preliminary Plat (PP) for a new residential subdivision. The following points contain key information:  20 single family homes on a 14.2-acre site.  New public streets with one access point off of Bright Road at the same location as an existing curb cut.  Four reserves, including the preservation of natural features and Billingsley Creek. Application Type and Process As outlined below, after the Concept Plan consideration, Rezoning/PDP is the second step in a three-step process for a PUD and is heard by both PZC and City Council (CC). The PP is also considered by both at this stage. The final determinations on the Rezoning/PDP and PP are made by City Council. 1. Concept Plan (CP) 2. Rezoning/PDP and PP (PZC Recommendation, CC Determination) 3. Final Development Plan (FDP) and Final Plat (FP) (PZC Recommendation, CC Determination) Site Plan City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 4 of 17 1. Background Site Summary The 14.2-acre site is zoned R-1, Restricted Suburban Residential District and is located north of the intersection of Grandee Cliffs Drive and Bright Road. The site contains two parcels: PID 273-008618 (the eastern parcel) is 10.60 acres and PID 273-0111149 (the western parcel) is 3.56 acres in area. The eastern parcel includes a steep, wooded ravine and a FEMA identified detailed floodplain (Zone AE), with floodway that follows Wright Run (Billingsley Creek) and a branch tributary. A single-family home located within this parcel was demolished in 2018 and the remaining structures include a small barn built in the 1970s. The barn does not appear to possess any historic or architectural significance. There is a grove of mature trees near the former home- site, and an asphalt driveway that provides access to Bright Road at the intersection with Grandee Cliffs Drive. The western parcel contains a swale and a wooded area referred to as West Wood. According to the City Engineer, the Stream Corridor Protection Zone does not apply to the swale on the western parcel. The site is bordered by single-family residential neighborhoods, which include members of the East Dublin Neighborhood Association. Hopewell Elementary School is located across Bright Road to the southeast, while the Holder-Wright Earthworks and Ferris-Wright Park are to the southwest, also across Bright Road. Bright Road has a rural character with no curbs, a ditch, many trees, and homes with large setbacks from the road. It has a low traffic volume, and was cul-de-sac'd by the City in 2020. A sensitive approach is essential to preserve the notable natural features of the site while maintaining the rural character of Bright Road, ensuring the preservation of Dublin’s overall character. Case History June 2024 - 24-073CP The Commission reviewed a concept plan and provided feedback for 20 single-family estate lots and site improvements. Commission members expressed support for the proposal, finding it responsive to the natural features with the clustered layout. The members recommended adding connectivity with the surrounding area, that open space be a focal point of the neighborhood and that the applicant address resident concerns. Neighborhood Engagement The applicant first provided an overview of the project during an East Dublin Civic Association (EDCA) meeting on May 15, 2024. Based on Commission’s feedback at the concept plan stage, the applicant attended another EDCA meeting to address the residents’ concerns resident concerns related to buffering of existing residential uses on October 29, 2024. 2. City Plans and Policies Community Plan The Community Plan is a key policy document used to guide decision-making for the future of the natural and built environment within Dublin. The Community Plan assists in the evaluation of development proposals and helps ensure that proposed development supports the community’s long-term objectives. City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 5 of 17 Future Land Use Plan The recommended future land use (FLU) for this site is Residential Low Density. This designation envisions large-lot residential development that takes into account environmentally sensitive areas and integrates existing natural features. The goal is to create a transition from a rural setting to suburban single-family residential neighborhoods. The FLU recommends single-family homes on at least 0.50 acre lots and a density of 0.5 to 2 du/acre. Bikeway Plan The City is currently working to extend the shared-use path along the south side of Bright Road. This path will cross Billingsley Creek and terminate at Grandee Cliffs Drive. Envision Dublin recommends that pedestrian and bicycle facilities be included on both sides of the road. However, given the rural character of Bright Road, which features natural elements such as the creek and mature trees and low traffic volumes, City staff is satisfied with a one-sided shared- use path on the south side of Bright Road. To ensure connectivity to the future shared-use path, crosswalks are proposed at two locations. A pedestrian crossing will be provided at the intersection of Bright Road and Grandee Cliffs Drive, allowing access to the shared-use path, as well as at the southwest corner of the site across from Ferris-Wright Park. The applicant will coordinate with staff regarding the timing of these pedestrian access connections. The site is not located within a Special Area Plan nor have new connections or widening of thoroughfares through the site been identified in the Thoroughfare Plan. Neighborhood Design Guidelines The City adopted the Neighborhood Design Guidelines (NDG) in March of 2023 to ensure that residential PUD developments are achieving the expectations outlined by Code. To that end, a number of analysis topics are included below. The intent of the NDG is to preserve the natural features. The site has natural features which restricts the development of the site to ensure that they are preserved. The details regarding the proposed preservation areas and new open space zones have been thoroughly outlined, including specific information about their locations and total acreage, along with the areas of the site conducive to residential development. Community Theme NDG aims to give each new neighborhoods a distinct sense of place by recognizing its unique features and safeguarding cultural and historical resources. The proposed layout prioritizes the preservation of the natural environment, with the circulation network and home sites designed to respect the existing topography. Vegetation along Bright Road, Billingsley Creek, West Wood, and the tree buffer along the northern and southern property lines are preserved to maintain the rural character of the site. Future Land Use Plan City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 6 of 17 Conservation Design Resolution (CDR)/Open Space Framework Analysis In 2004, the City Council amended a resolution that established guidelines for Conservation Design development. The purpose of these Conservation Design guidelines is to create visually appealing and vibrant neighborhoods while safeguarding environmentally sensitive areas. This is achieved by promoting innovative site planning and allowing deviations from standard development regulations and conventional subdivision designs. The preservation of existing natural features is given the highest priority as dedicated open space in the layout of the neighborhood and are addressed as public focal points of the neighborhood. The open spaces are conveniently accessed from all the lots. 3. Project Layout The entrance to the proposed subdivision will be via Bright Road, utilizing the existing access point that aligns with the intersection of Bright Road and Grandee Cliffs Drive. This design limits the need for any additional access points to Bright Road. The subdivision layout features two new curvilinear streets, designated as Streets A and B, with Street B ending in a cul-de-sac (“East Court”). The lots are oriented internally toward these streets and are clustered in the central part of the subdivision to preserve the existing natural features of the site with minimal impact to the surroundings. Design of Preservation & Open Space Areas The proposal maintains the Billingsley Creek corridor and the “West Wood” area as the two main public open spaces. Existing tree row lining the north property boundary (“North Buffer”) and Bright Road (“South Buffer”) are proposed as No-Build Zones. Reserve B Billingsley Run Public Open Space Reserve A West Wood Public Open Space Open Spaces Areas Reserve C Central Court City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 7 of 17 The 2.40-acre West Wood area, primarily consisting of volunteer tree growth, will be developed as a community open space and will include necessary stormwater management facilities. The NDG only consider dry stormwater detention facilities as contributing open space when these areas achieve a superior and interactive design as useable open space. The proposal exhibits pedestrian paths leading to the stormwater facility from the Allee open space as well as from Bright Road at the southwest corner of the site. As described later in the report, additional interventions are required to ensure that the West Wood (Reserve A) is a usable open space, which are described further in the report. The 3.11-acre Billingsley Run (Reserve B) will be preserved in its natural state. The Central Court and East Court are designed to provide open space connections. The Central Court is a proposed reserve in the central portion of the lot surrounded by streets with homes facing the open space. It is intended to be a gathering space for residents and is supplemented by an open space connection to the West Wood reserve. The preliminary design includes a perimeter flush curb, clusters of birch trees and a location of a clustered mailbox facility. Proposed Ownership and Maintenance of Public Open Spaces Space Ownership Maintenance Reserve A: West Wood City of Dublin City of Dublin Reserve B: Billingsley Run City of Dublin City of Dublin Reserve C: Central Court City of Dublin HOA Reserve D: East Court City of Dublin HOA Connections to City Networks The proposed development is an infill project surrounded by single-family residential neighborhoods and is accessed only via Bright Road, which is a cul-de-sac. No additional road connections are planned for this development. A small portion of the site borders Bright Road across Ferris-Wright Park. To facilitate maintenance of the detention basin, a 10-foot wide shared use path will be provided as an access corridor from Bright Road. A crosswalk is provided at the south terminus of the shared use path, connecting the development to the existing Ferris Wright Park preservation area. The developer is also proposing an 8-foot wide specialty pavement path, approximately 140 feet long, to be constructed from Central Court to the east side of the detention basin, giving residents access to the West Wood and community open space. Staff recommends a continuous shared-use path from Bright Road to the neighborhood, ensuring pedestrian and ADA connectivity throughout the proposed development from the southwestern portion of the site. The shared use paths are recommended to be constructed per the City’s standards. If the applicant intends a specialty path to align with the development character, the maintenance responsibilities of the path should be described in the development plan. Streetscape Network The portion of the streetscape between the sidewalk and the front façades of the homes is one of the most prominent, character defining elements of the neighborhood. The NDG recommends landscape design, architectural design, architectural materials, and the initial impression the space creates for both pedestrian and vehicular movement. City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 8 of 17 The narrow streetscape is proposed with indigenous street trees and a concrete or a specialty paved sidewalk on one side of the street with several access points from the sidewalk to Street B. All homes are front-facing homes along the street segments allowing for more intimate corridor dimensions emphasizing the community theme. The proposed streets will be public. ‘Street A’ is a 50-foot-wide right-of-way (26-foot-wide pavement) extending from the Bright Road intersection to the first internal intersection. The remainder of this street as well as ‘Street B’ would have a 40-foot-wide right-of-way (24-foot- wide pavement). While the City recommends a 60 foot wide right-of-way, subdivision regulations require a minimum of 50 feet. Due to the size and isolated nature of the proposed neighborhood, the proposed street hierarchy is limited to these street widths. When vehicles are parked on one side of these streets, the overall travel width decreases to between 15 and 17 feet, which may necessitate one vehicle yielding to an oncoming one. The streets are designed to provide an intimate streetscape with minimal through-traffic, the limited number of lots, and the low travel speeds. 5-foot sidewalks, are proposed along the eastern side of Street A (Lots 17-20), and then the southern (lots 16 and 17) and western sides (lot 13-16) of Street B. The remainder of the neighborhood are proposed with ADA-accessible driveways to accommodate access to the sidewalk on the opposite side of the street and provide access to the Central Court. This design intentionally departs from the required standards to preserve green spaces and maintain the rural character of the proposal. However, per the recently adopted City standards, 6-foot sidewalks are required on both sides of the street with any development. Staff has requested that the applicant provide factual details and implications of providing sidewalks on both side of the street and their impact on the proposed development. The applicant has provided a cross- section to show the required sidewalk on both sides and its City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 9 of 17 impact to the intended street character of the proposed development. However, no drawings are presented for staff to determine if the sidewalks would impact the development standards and the proposed layout and if they would deviate from the current layout and the intended theme of the proposal. Front yard Character and Landscape The front yard character is intended to provide a village streetscape. Each home is to be custom designed with variation of materials home to home and a well detailed front yard is envisioned for the neighborhood. Entry gardens with foundation plantings, hedges, walls/piers, fencing segments and other devices are proposed to match the character of the home. At FDP, specific front yard planting requirements must be provided. A diverse mix of naturalistically planted street trees is appropriate to the character of the site. The development text notes a 5-foot-wide tree lawn noted as standard throughout the development, but the drawings indicate 5.5-foot wide tree lawn, which tapers down to a narrower tree lawn, not adequate for a tree plantation. Code requires a minimum of 5-foottree lawn, and Envision Dublin recommends an 8-foot tree lawn. The applicant must ensure that a uniform tree lawn is noted on the development plan and there are no discrepancies between the development text and the PDP drawings. Additionally, the landscape plan does not match the lot layout, and the submitted development drawings have discrepancies Restoration or removal of the existing fencing along Bright Road is to be determined by the applicant at FDP, no entry feature is proposed for the development. Per NDG, transitional arrival and entry spaces located in relation to the street are recommended. Given the nature of the development and intent, the proposed tree buffer maintains the rural character of Bright Road. Development Standards The applicant has indicated that the development is intended to be sensitive to the established character of the surrounding single-family neighborhoods, while conserving the existing natural features on the site. In order to align with the community theme, the development standards differentiate between the Perimeter Lots and Interior Lots. The Lot Type Example exhibits effectively depict a range of conceptually developed lots, as recommended by the NDG. Front Yard Character Images City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 10 of 17 NDG Elements – Public Realm Macro Comments Open Space Framework  A site inventory, narrative analysis of the various site features provided describing the significance and potential influence of the existing conditions  Location and acreage of proposed preservation areas and new open space is provided  Additional details required regarding the proposed recreational path through the West Wood Preservation of Significant Features  Preservation of Billingsley Run floodway and West Woods  Preservation of existing northern and southern tree buffer Objectives for Open Space  Central Court: Newly created open space in the central portion for residents  Formal open space between Lots 4 and 5 linking the Central Court and the West Wood.  Both spaces meet the design objectives of the NDG Stormwater Facilities  Detention basin within the West Wood, planted and protected as an open space Reserve.  Further details and clarifications are needed as to the degree of pedestrian access within Reserve A NDG Elements – Public Realm Micro Comments Streetscape  Diverse mix of naturalistically planted street trees proposed  Space available in the proposed tree lawns does not meet Code requirements Pedestrian Experience  Pedestrian facilities not incorporated on both sides of neighborhood streets Front Yard Landscaping/Arrival  Incorporation of fences, walls, and piers is consistent with the NDG for homes where short setbacks are proposed.  No specific front yard planting requirements are proposed at PDP, detailed requirements must be provided at the FDP  More flexibility in the siting of driveways and home (Lot 2,5 and 13) Architectural Diversity  All homes are to be custom designed to conform to the conditions, topography, configuration and restrictions of its lot.  No specific architectural plans provided  High quality, 1.5 to 2 stories in height with 2 to 3 car garages Garage Mitigation  18 feet wide garages  To ensure that the objectives of the NDG, minimum setbacks should be included in the Development Text for front and side loaded garages relative to the front façade of the home. NDG Elements – Private Realm Comments Block Vignettes  Required now, including corner and side-loaded vignettes; not provided Front Setback  15’-20’ Side Yards  6’ shown each side;  The NDG recommends 6 feet on one side and 14 feet total Rear Yard/Private Open Space  There are a number of inconsistencies in the numeric standards proposed for several of the lots for these element Lot Coverage  45% Includes primary structure, enclosed auxiliary structure, driveways, entry walks, paved terraces/patios, decks, masonry terraces/patios (excludes open trellises and pergolas) Lot Area  9,960 Square feet (Minimum), 21,443 Square feet  (Maximum) Minimum Lot Width  29 feet (minimum) Minimum Lot Depth  107 feet City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 11 of 17 The lot sizes are typically larger along Bright Road and along the northern parcel line, to align with the adjacent lot sizes. The mix of lot sizes aligns with the Community Plan recommendations, however the minimum lot size does not align with the minimum lot requirements of 0.5-acre. Given the sensitive approach to preserve the existing natural features, staff is supportive of the proposed lot sizes which vary from 0.22-acre to 0.49-acre. Lot sizes and setbacks vary throughout the development with varying lot widths. Lots 2, 5, 10, and 13 are the inside corner lots with narrow widths varying from 29 feet at Lot 5 to 43.1 feet at Lot 10. Staff recommends that a minimum of 40-foot lot width be maintained at all the inside corner lots to ensure flexibility in the driveway and front yard landscaping opportunities, which is an essential component of the neighborhood. The lots sizes and locations dictate the side and rear yard setbacks. The minimum side yard setback is 6 feet. The NDG recommend that in no case shall the side yards be less than 6 feet on one side and 14 feet total. The Development Text proposes a range of dimensional requirements for rear yards and private open space areas which are unique to lots based on the lot configuration. For lots 1-10, based on the information provided, the minimum depth of private open spaces is not accurate and there are a number of inconsistencies in the numeric standards proposed for several of the lots for these elements, such that the numbers do not add up correctly. This information was requested multiple times, but not properly addressed by the applicant. Revisions will be required to the Development Text to ensure that adequate depth is available for both the buildable area of the house and private open space while maintaining a minimum rear yard buffer to the adjacent lot. To ensure that the objectives of the NDG are met, minimum setbacks should be included in the Development Text for front and side loaded garages relative to the front façade of the home. The proposed lot coverage is 45% and is consistent with other similar sized lots within the City and the NDG recommendations Architecture and Building Materials The development will consist of custom build, high-quality, single-family 1.5 to 2 stories tall homes, featuring 2 or 3 car garages. The homes will be designed with a theme that will reflect the Midwestern Vernacular and European Country styles homes along with some Gothic elements from farmhouse designs, a style prevalent in Dublin and nearby communities. Building Materials The applicant is proposing to permit a variety of primary cladding materials including: full-depth brick, thin brick, stone, manufactured stone, wood, stucco, cementitious siding, or any Architectural Character City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 12 of 17 combination thereof. The proposed development text also defines permitted trim materials that include: wood, cementitious board, and aluminum (for gutters and downspouts only). Permitted roof materials are dimensional asphalt shingles (25 years or 240lbs/sq weight), wood slate, copper, standing seam metal and/or tile. Windows and Door will incorporate trim that is architecturally appropriate. Architectural elements include specialty shaped windows, louvers, shutters, entry coverings, and other features. Chimneys are permitted with exterior portions to be finished in brick, stone or manufactured stone. Garages are to be consistent with the main building façade with decorative garage doors and a maximum width of 18 feet. Per the development text, garage orientation may be determined based on the individual site topography. No more than one yard post is permitted near the entry walk and properly designed accent light is allowed and encouraged. Outdoor terraces, decks, pool and dining areas are permitted as a part of the overall architectural character of home. All the ground mechanical equipment is to be located and screened through architecture and/or landscape to minimize visibility and noise. Maximum building height is 35 feet, as per Code. Front yard fences include ornamental metal, painted/stained wood, stone, or a combination thereof in keeping with the character of the house design and as approved by the HOA. The fences are intended to define the “semi-public” space that is the home entry area and not enclose the front yard. The HOA will establish an Architectural Review Board (ARB) to evaluate each homesite and building plan in the development for compliance with the Development Standards put forth by the FDP. The Developer, as the sole builder of these custom homes, will serve as the ARB and retain control of individual plan approval within the development until such time that all lots are constructed. Stormwater Management, Utilities & Easements The proposal will meet the requirements of the City of Dublin Chapter 53, Stormwater Management and Stream Protection Code by constructing multiple stormwater management detention basins, storm sewer pipes, and associated structures. The applicant has located and sized these facilities based on a stormwater management report that analyzed the existing and anticipated drainage for the area and have provided calculations for the sizing of the detention basins. The applicant will need to continue to work with Division of Engineering to demonstrate compliance in accordance with Chapter 53 of the Dublin Code of Ordinances. A stream corridor protection zone is located near the eastern portion of the site. This area has been delineated and has been kept free of proposed buildings, stormwater management facilities and other prohibited uses in this zone. Public water for domestic and fire protection use will be available by the construction of new public water main from Bright Road. A new public sanitary sewer is proposed with this development to provide service for the proposed lots. The West Wood will serve as a stormwater management area, located at the lower end of the site's watershed and defined by preserved trees along its perimeter. Additional plantings will enhance this space, creating an outdoor area for the enjoyment of residents and neighbors alike. A 10-foot wide paved path for the periodic maintenance of the outflow structure of the detention basin in West Wood is provided. An 8-foot wide specialty pavement path City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 13 of 17 approximately 140 feet in length is provided from Central Court to the east side of the detention basin. The path must meet City standards. It is important to note that there are discrepancies between the drawings and unresolved comments. Addressing these items may impact the overall site layout as presented. These items include the locations of sanitary sewer and storm sewer easements. 4. Preliminary Plat Summary This is a proposal for a Preliminary Plat for the subdivision of 14.2-acres of land and includes the creation of 20 single-family lots, four open space reserves, and two public streets. The Preliminary Plat shows existing conditions, proposed development sections, setback requirements, lot depths and widths. The plat does not currently show easements as required. The plat includes the open space acreages, ownership, and maintenance responsibilities. The single-family lots range in size with the smallest lot at 9,960 square feet and the largest lot at 21,433 square feet. The minimum lot width is 29 feet (Lot 5), and the minimum lot depth is 107 feet (Lot 19). Single-family residential setbacks are not platted but rather are defined by the development text. Entrances to subdivisions typically require a dedicated left-turn lane. However, with Bright Road being a cul-de-sac west of the site and the low traffic volumes, there is no need for dedicated left-turn lanes in this case. The Traffic Impact Study (TIS) indicates minimal impact on the surrounding roadway network, and no turn lanes are required for access to the site from either direction. Street A is proposed to provide access from Bright Road with no other access point to the subdivision. The plat establishes a 15-foot front building line for each lot along the public right-of-way. A 20-foot landscape easement is on the northern and southern property lines. The associated utility easements are not denoted on the plat as required. All proposed streets are public. The Subdivision Regulations require land dedication for open space and for recreational facilities. The applicant is required to provide a minimum of 0.88-acres for open space for the site based on the area and number of single-family lots. The proposal is for 5.8-acres of open space of which all is to be dedicated to the City. Grading plans are expected to be shown on the Preliminary Plat, and the currently indicated grading on the house pads may require significant work and could potentially impact the floodplain. 5. Plan Review Criteria Review 1. The proposed development is consistent with the purpose, intent and applicable standards of the Zoning Code. Criterion Met with Condition: This proposal is generally consistent with the purpose, intent and applicable development standards of the Zoning Code requirements. Establishment of a Planned Unit Development successfully addresses the Preliminary Development Plan City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 14 of 17 unique conditions and location of the site. 6-foot sidewalks on both sides of each street are required per City’s current standards and this condition must be addressed prior to City Council Review. 2. The proposed development is in conformity with Community Plan, Thoroughfare Plan, Bikeway Plan, and other adopted plans or portions thereof as they may apply and will not unreasonably burden the existing street network. Criterion Met with Conditions: The proposed infill development largely meets the goals and objectives defined in the Community Plan including the Future Land Use designation for the site. The development preserves the natural character along Bright Road. A connected shared use path within Reserve A is required to establish the shared use path connection and must be shown prior to City Council review. Additionally, two-sided 6-foot sidewalks are required per City’s current standards and this condition must be addressed prior to City Council Review. 3. The proposed development advances the general welfare of the city and immediate vicinity and will not impede the normal and orderly development and improvement of the surrounding areas. Criterion Met: The proposed development promotes orderly development that is respectful to the surrounding development character. 4. The proposed uses are appropriately located in the city so that the use and value of property within and adjacent to the area will be safeguarded. Criterion Met: The Future Land Use Plan identifies this location for Residential Low Density that takes into account environmentally sensitive areas and integrates natural features. The proposed development safeguards the existing rural setting along Bright Road and along the Perimeter Lots. 5. Proposed residential development will have sufficient open space areas that meet the objectives of the Community Plan. Criterion Met: The required open space is 0.88acres and the applicant proposes 5.8 acres of large open public spaces, satisfying and exceeding the requirements. The applicant should work with the City’s landscape inspector to ensure the tree survey, tree preservation plan, tree removal/replacement plan, and landscape plan are provided with the Final Development Plan submittal. 6. The proposed development respects the unique characteristic of the Criterion Met: Billingsley Creek has been kept free of proposed buildings. The West Wood area is envisioned to maintain its natural character. City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 15 of 17 natural features and protects the natural resources of the site. The proposal will have to adhere to Code for any removal and replacement of the vegetation on site, details of which are required at the Final Development Plan. 7. Adequate utilities, access roads, drainage, retention and/or necessary facilities have been or are being provided. Criterion Met with Condition: The proposal will meet the requirements of the City of Dublin Chapter 53 Stormwater Management and Stream Protection Code by constructing stormwater management detention basin, storm sewer pipes, and associated structures. The site survey and grading must be provided and shown on the drawings prior to City Council Review. 8. Adequate measures have been or will be taken to provide ingress and egress designed to minimize traffic congestion on the surrounding public streets and to maximize public safety and to accommodate adequate pedestrian and bike circulation systems to that the proposed development provides for a safe, convenient and non-conflicting circulation system for motorists, bicyclists and pedestrians. Criterion Met with Condition: The Traffic Impact Study indicates minimal impact on the surrounding roadway network, and no turn lanes are required for access to the site from either direction. A shared use path is required to connect the south-west portion of the site to the development. 9. The relationship of buildings and structures to each other and to such other facilities provides for the coordination and integration of this development within the PD and the larger community and maintains the image of Dublin as a quality community. Criterion Met with Condition The preservation of natural features and integration with the proposal maintains the image of Dublin as a quality community. As mentioned above, a shared use path is required to ensure that the pedestrian connectivity is well established and integrated with the neighborhood. 10. The density, building gross floor area, building heights, setbacks, distances between buildings and structures, yard space, design and layout of open space systems and parking areas, traffic accessibility and other elements having a bearing on the overall acceptability of the development plans contribute to the orderly development of land within the city. Criterion Met with Condition: The proposed density is compatible with surrounding development, as are the lot and building development standards. The applicant must ensure that sidewalk are provided on both sides of each street and the integration of the shared- use path is shown prior to City Council Review. 11. Adequate provision is made for storm drainage within and through the site so as to maintain, as far as Criterion Met: The proposal will meet the requirements of the City of Dublin Chapter 53 Stormwater Management and Stream Protection Code by constructing stormwater management City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 16 of 17 practicable, usual and normal swales, water courses and drainage areas. detention basin, storm sewer pipes, and associated structures. 12. The design, site arrangement, and anticipated benefits of the proposed development justify any deviation from the standard development regulations included in the Zoning Code or Subdivision Regulations and that any such deviations are consistent with the intent of the PUD regulations. Criterion Met: The proposed site layout is responsive to surrounding context and in accordance with the Community Plan. The flexibility provided by the Planned Unit Development process is necessary in this case to address the unique natural features of the site and maintain the significant natural features, resulting in lot sizes less than 0.5-acre. 13. The proposed building design meets or exceeds the quality of the building designs in the surrounding area and all applicable appearance standards of the city. Criterion Met: The development text includes material and designs standards. The proposed building materials are high-quality materials and compatible with the surrounding neighborhoods. Conceptual architectural elevations have been provided by the applicant. 14. The proposed phasing of development is appropriate for the existing and proposed infrastructure and is sufficiently coordinated among the various phases to ultimately yield the intended overall development. Not Applicable: No phasing information has been provided by the applicant. 15. The proposed development can be adequately serviced by existing or planned public improvements and not impair the existing public service system for the area. Criterion Met: All public improvements in this location are based on the construction of this project; these improvements are otherwise not planned. 16. The applicant’s contributions to the public infrastructure are consistent with the Multimodal Thoroughfare Plan and are sufficient to service the new development. Criterion Met: The site is not located within a Special Area Plan nor any Thoroughfares plan. Criteria Review 1. Plat Information, Zoning Code, and Construction Requirements. Criterion Met with Conditions: The proposal is largely consistent with the Subdivision Regulations. Applicant must show the site survey, easements, grading and make any technical adjustments prior to City Council review. 2. Lots, Street, Sidewalk, and Bike Path Standards Criterion Met with Condition: The plat does not provide sidewalk on both sides as per City standards. Also, a connected shared use path Preliminary Plat City of Dublin Planning and Zoning Commission 24-135Z-PDP & 24-151PP | Bright Road Reserve Thursday, February 6, 2025 Page 17 of 17 within Reserve A is required. Applicant must make revisions prior to City Council Review. 3. Utilities. Criterion Met: Stormwater management, proposed and existing utilities are shown on the plat. 4. Open Space Requirements Criterion Met with Condition: The proposed open space provision meets the requirements. Open space is required to be dedicated to the City. The plat must accurately shows the ownership and maintenance of specialty path of Reserve A. Applicant must make these prior to City Council Review. Recommendation Planning Recommendation: Recommendation to City Council of approval of Rezoning and Preliminary Development Plan with the following conditions: 1) The applicant provide a 6-foot wide sidewalk on both sides of streets in the subdivision and revise the development text accordingly, prior to City Council submittal. 2) The applicant provide a connected shared use path in Reserve A, per the City’s maintenance standards and revise the development text as required, prior to City Council submittal. 3) The applicant make adjustments to Lot 2, Lot 5 and Lot 13 to provide a minimum lot width of 40 feet to achieve more flexibility in driveway location and provide landscaping opportunities for a cohesive residential appearance and revise the development text to require the minimum lot width of 40 feet, prior to City Council submittal. 4) The applicant provide a uniform tree lawn within the entire development without any discrepancies between the drawings prior to City Council submittal. 5) The applicant revise the development text to address the discrepancies between the rear yard setbacks, primary structure setback and minimum private open spaces on Lots 1- 10 prior to City Council submittal. 6) The applicant revise the development text to require minimum side yard dimension as 6 feet on one side and 14 feet total prior to City Council submittal. 7) The applicant revise the development text to provide minimum setbacks for the front- loaded and side-loaded garages, prior to City Council submittal. Planning Recommendation: Recommendation to City Council of approval of Preliminary Plat with the following conditions. 1. The applicant ensure that the site survey, easements, grading, and engineering comments are shown on the plat prior to City Council submittal. 2. The applicant address any other technical adjustment as needed. BRIGHT ROADMACDUFF PLACEMAC B E T H DRIV E HANNA HILLS DRIVEBRIGHT ROADGRANDEE CLIFFS DRIVESTREET ASTREET B6321131914161718478910111252015Drawing Number:Project Number:Drawn By:Date:Scale:Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY DEVELOPMENT PLANBRIGHT ROAD RESERVEVICINITY MAPPRELIMINARY DEVELOPMENT PLANFORBRIGHT ROAD RESERVECITY OF DUBLIN, FRANKLIN COUNTY, OHIOINDEX MAPSHEET INDEXFLOODPLAINLEGALLANDOWNERDEVELOPERENGINEER & SURVEYORLAND PLANNING/LANDSCAPEARCHITECTUREARCHITECTURESITEGRAPHIC SCALE01 inch = 100 feet20050 100TITLE SHEET/VICINITY MAP/REGIONAL CONTEXT MAPPREPARED BY:UTILITY & SERVICE CONTACTS BRIGHT ROADBRIGHT ROADGRANDEE CLIFFS DRIVEGwd5C2Ble1B1Gwe5B2Ble1B1Ble1B1Ble1B1Ble1B1Gwd5C2MIC2MIC2MIC2CeBMkB10.606 Ac.3.568 Ac.Drawing Number:Project Number:Drawn By:Date:Scale:Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY DEVELOPMENT PLANBRIGHT ROAD RESERVEEXISTING CONDITIONS PLANGRAPHIC SCALE01 inch = 50 feet10025 50SOIL MAP UNIT LEGENDLEGEND STREE T A STREET BSTREET BSTREET BBRIGHT ROADGRANDEE CLIFFS DRIVEBRIGHT ROADDrawing Number:Project Number:Drawn By:Date:Scale:Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY DEVELOPMENT PLANBRIGHT ROAD RESERVEPRELIMINARY PLAT/DEVELOPMENT PLANGRAPHIC SCALE01 inch = 50 feet10025 50NOTES:SITE STATISTICS STREET A STREET BSTREET BSTREET BBRIGHT ROADGRANDEE CLIFFS DRIVE6321131914161718478910111252015Drawing Number:Project Number:Drawn By:Date:Scale:Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY DEVELOPMENT PLANBRIGHT ROAD RESERVEUTILITY PLANGRAPHIC SCALE01 inch = 50 feet10025 50NOTES:LEGEND STREE T A STREET BSTREET BSTREET BBRIGHT ROADGRANDEE CLIFFS DRIVE6321131914161718478910111252015Drawing Number:Project Number:Drawn By:Date:Scale:Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY DEVELOPMENT PLANBRIGHT ROAD RESERVEGRADING AND DRAINAGE PLANGRAPHIC SCALE01 inch = 50 feet10025 50LEGENDNOTES: STREE T A STREET BSTREET BSTREET BBRIGHT ROADGRANDEE CLIFFS DRIVEBRIGHT ROADDrawing Number:Project Number:Drawn By:Date:Scale:Checked By:PRELIMINARY NOTFOR CONSTRUCTION4338 BRIGHT ROADPARTNERS, LLC8824 DUNSINANE DRIVEDUBLIN, OHIO 43017PRELIMINARY DEVELOPMENT PLANBRIGHT ROAD RESERVEVEHICLE TRACKING EXHIBITGRAPHIC SCALE01 inch = 50 feet10025 50 150'50'25'0'SheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer7OPEN SPACEFRAMEWORK PLANCONNECTIVITY24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25NORTH CENTRAL GREENWEST WOODBILLINGSLEYRUNBRIGHT ROAD 1234567891011121314151617181920MAINTENANCE PATHPEDESTRIAN PATHBRIGHT ROAD150'50'25'0'SheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer8ILLUSTRATIVE PLAN24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25NORTH 868889221919294879596971131811792012001992475855545372717078767779808112131130141628292726221831333441404547485150494668668283564318485223225215240232127615956657910875744373423244393537362513813914016616716914212812912610510423924624524124424324221118718517118916516414116317316116015813413313113014814915011912312212110610710811711611011111511411215315215114716817013713613212412513514414317218614514610910310210110099989320320218090220219218204205217216224222184182183154155156177178175174159157226229230227228202231233234235238213212206207208209210193192190188194191198197196195523815242321201917257606369676264120118162176AREAS OF TREEPRESERVATION, EXISTINGTREES NOT SURVEYED.150'50'25'0'SheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer9TREE SURVEY24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25NORTH SheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer10TREE DATA24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25#COMMON NAME DBH CONDITION1 *FRUITING PEAR 17.0 FAIR# COMMON NAMECONDITION51 *FRUITING PEARDBH15.02RED MAPLE 6.0 FAIR52PIN OAK25.03 SUGAR MAPLE 17.0 POOR53 RED MULBERRY 8.04 SUGAR MAPLE 14.0 POOR54 BLUE SPRUCE 10.05RED MAPLE 9.0 FAIR55 WHITE SPRICE 9.06RED MAPLE 14.0 FAIR56 BLUE SPRUCE 12.07 RED MULBERRY 26.0 FAIR57 BLACK WALNUT 6.08RED MAPLE 11.0 FAIR58 BLACK WALNUT 8.09 BUTTERNUT 20.0 FAIR59 NORWAY SPRUCE 16.010 FRUITING PEAR 17.0 POOR6014.011 BUTTERNUT 26.0 GOOD6110.012 RED MAPLE 9.0 GOOD6212.013 AMERICAN SYCAMORE 28.0 GOOD6313.014 EASTERN HEMLOCK 8.0 GOOD649.015 BLUE SPRUCE 6 FAIR6513.016 RIVER BIRCH 13.0 FAIR6613.017 NORTHERN RED OAK 28.0 GOOD679.018 AUSTRIAN PINE 13.0 POOR6810.019 AUSTRIAN PINE 9.0 POOR696.020 AUSTRIAN PINE 8.0 POOR70 RED MAPLE 12.021 AUSTRIAN PINE 8.0 POOR71 SILVER MAPLE 19.022 HONEYLOCUST 15.0 GOOD72 EASTERN WHITE PINE 16.023 HONEYLOCUST 16.0 GOOD73 CALLERY PEAR 11.024 AUSTRIAN PINE 16.0 FAIR74 EASTERN WHITE PINE 18.025 HONEYLOCUST 16.0 GOOD7529.026 HONEYLOCUST 16.0 POOR76 RED MAPLE 9.027 HONEYLOCUST 35.0 FAIR77 RED MAPLE 12.028 HONEYLOCUST 14.0 FAIR78 FRUITING PEAR 10.029 HONEYLOCUST 13.0 FAIR79 RED MAPLE 10.030 RED MAPLE 9.0 FAIR8010.031 BALD CYPRESS 15.0 FAIR8110.032 AMERICAN SYCAMORE 44.0 GOOD8210.033 JAPANESE RED PINE 9.0 FAIR839.034 EASTERN REDBUD 30.0 FAIR8414.035 BLACK WALNUT 20.0 GOOD8511.036 BLACK WALNUT 18.0 GOOD86 BLACK WALNUT 16.037 HICKORY - SHAGBARK 10.0 GOOD87 EASTERN WHITE PINE 21.038 HICKORY - SHAGBARK 14.0 GOOD88 AMERICAN ELM 6.039 NORWAY SPRUCE 17.0 FAIR89 AMERICAN ELM 10.040 CHERRY SPECIES 10.0 POOR90 AMERICAN ELM 11.041 EASTERN COTTONWOOD 40.0 GOOD91 SUGAR MAPLE 6.042 AMERICAN SYCAMORE 30.0 FAIR92 AMERICAN ELM 8.043 SILVER MAPLE 41.093ASH19.044 AMERICAN SYCAMORE 30.094 KENTUCKY COFFEETREE 20.045 RED MAPLE 12.09518.046 RED MAPLE 10.096 BOXELDER 10.047 BLUE SPRUCE 10.097 SUGAR MAPLE 12.048 RED MAPLE 11.098 SUGAR MAPLE 8.049 BLACK CHERRY 10.099 BLACK WALNUT 18.050 FRUITING PEAR 8.0100 SUGAR MAPLE 6.0# COMMON NAMECONDITIONDBH101 SUGAR MAPLE 8.0102 AMERICAN ELM 10.0103 BLACK WALNUT 19.01047.010514.010619.010724.0108 AMERICAN ELM 20.0109 BLACK CHERRY 6.0110 SUGAR MAPLE 9.011115.011216.011320.011430.0115 SUGAR MAPLE 10.0116 BLACK WALNUT 15.0117 HONEYLOCUST 23.0118119 SUGAR MAPLE 9.0120 AMERICAN ELM 6.0121 BLACK WALNUT 20.0122 SUGAR MAPLE 11.0123 BLACK CHERRY 10.0124 SUGAR MAPLE 6.0125 AMERICAN ELM 9.0126 HONEYLOCUST 39.0127 HONEYLOCUST 10.0128 SUGAR MAPLE 6.0129 SUGAR MAPLE 12.0130 SUGAR MAPLE 10.0131ASH14.0132 SUGAR MAPLE 10.0133 SUGAR MAPLE 8.0134 SUGAR MAPLE 9.0135 BLACK WALNUT 23.0136 AMERICAN ELM 9.0137 BOXELDER 6.0138 AMERICAN ELM 7.0139 AMERICAN ELM 8.0141 AMERICAN ELM 17.01427.014310.01446.0145 SUGAR MAPLE 15.0146 BLACK WALNUT 18.0147 AMERICAN ELM 8.0148 SUGAR MAPLE 10.0149 SUGAR MAPLE 10.0150 BLACK CHERRY 9.0# COMMON NAMECONDITION151 AMERICAN ELMDBH9.0152 BLACK WALNUT 19.0153 BLACK CHERRY 7.0154 BLACK CHERRY 6.0155 AMERICAN ELM 6.0156 BLACK WALNUT 22.0157 AMERICAN ELM 8.0158 AMERICAN ELM 8.0159 BLACK WALNUT 16.0160 SUGAR MAPLE 8.0161 SUGAR MAPLE 7.0162 AMERICAN ELM 16.0163 BLACK WALNUT 17.0164 SUGAR MAPLE 8.0165 AMERICAN ELM 6.0166 AMERICAN ELM 9.0167 NORTHERN HACKBERRY 11.01686.0169 BLACK WALNUT 35.01707.017112.01727.01736.01748.017510.01768.0177 AMERICAN ELM 6.0178 SUGAR MAPLE 7.0179 BLACH CHERRY 10.0180 AMERICAN ELM 6.0181 BLACK CHERRY 8.0182 BLACK WALNUT 16.0183 AMERICAN ELM 12.0184 BLACK WALNUT 24.0185 BLACK WALNUT 20.0186 AMERICAN ELM 6.0187 BLACK WALNUT 8.0188 NORTHERN HACKBERRY 9.0189 NORTHERN HACKBERRY 8.0190 BLACK WALNUT 19.0191 BLACK WALNUT 17.0192 BLACK WALNUT 8.0193 BLACK WALNUT 12.0194 AMERICAN ELM 8.0195 BLACK WALNUT 27.0196 BLACK WALNUT 9.0197 BLACK WALNUT 9.0198 AMERICAN ELM 7.0199 BLACK WALNUT 18.0200 AMERICAN ELM 7.0# COMMON NAMECONDITIONDBH201 AMERICAN ELM 6.0202 AMERICAN ELM 8.0BLACK WALNUT 18.0AMERICAN ELM 8.0AMERICAN ELM 12.0HONEYLOCUST 21.0AMERICAN ELM 9.0SUGAR MAPLE 8.0HONEYLOCUST 18.0AMERICAN ELM 11.0AMERICAN ELM 11.0BLACK WALNUT 23.0BLACK WALNUT 20.0AMERICAN ELM 6.0AMERICAN ELM 6.0BLACK WALNUT 28.0KENTUCKY COFFEETREE 22.0AMERICAN ELM 15.0SUGAR MAPLE 15.0SUGAR MAPLE 15.0AMERICAN ELM 15.0SUGAR MAPLE 15.0AMERICAN ELM 15.0EASTERN WHITE PINE 13.012.018.015.015.08.022.020.013.016.014.017.0EASTERN WHITE PINE 10.0BLACK WALNUT 13.0RED MULBERRY 11.011.010.012.0AMERICAN ELM 7.0NORTHERN HACKBERRY 16.0BLACK WALNUT 11.0FLOWERING CRABAPPLE 72.0POORGOODGOODGOODGOODGOODDEADPOORFAIRGOODFAIRFAIRPOORFAIRFAIRFAIRGOODGOODGOODGOODGOODFAIRGOODFAIRFAIRGOODGOODFAIRPOORFAIRGOODFAIRFAIRDEADDEADFAIRGOODFAIRFAIRFAIRFAIRGOODFAIRPOORFAIRGOODFAIRFAIRFAIRFAIRPOORFAIRDEADFAIRGOODGOODGOODGOODGOODGOODGOODFAIRFAIRGOODFAIRGOODGOODFAIRFAIRFAIRPOORFAIRFAIRFAIRPOORPOORPOORGOODGOODDEADDEADFAIRGOODGOODDEADGOODFAIRPOORGOODGOODGOODFAIRGOODGOODGOODFAIRFAIRGOODFAIRPOORFAIRGOODDEADGOODGOODGOODFAIRFAIRPOORGOODPOORFAIRFAIRFAIRFAIRGOODGOODPOORFAIRFAIRFAIRGOODGOODGOODGOODGOODFAIRDEADGOODFAIRPOORGOODGOODDEADGOODGOODGOODGOODPOORFAIRPOORFAIRFAIRPOORPOORPOORPOORFAIRFAIRPOORGOODFAIRFAIRFAIRPOORFAIRPOORGOODFAIRPOORGOODFAIRFAIRFAIR FAIRFAIRFAIRFAIRFAIRFAIRGOODGOODDEADGOODFAIRFAIRPOORGOODGOODPOORFAIRFAIRGOODFAIRFAIRPOORFAIRPOORFAIRPOORPOORFAIRPOORFAIRFAIRFAIRPOORFAIRFAIRFAIRPOORNORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCENORWAY SPRUCEEASTERN WHITE PINERED MAPLERED MAPLERED MAPLERED MAPLERED MAPLERED MAPLEKENTUCKY COFFEETREEBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTBLACK WALNUTSUGAR MAPLE9.0 FAIR140 AMERICAN ELM 8.0 FAIRSUGAR MAPLESUGAR MAPLESUGAR MAPLENORTHERN HACKBERRYNORTHERN HACKBERRYNORTHERN HACKBERRYAMERICAN ELMAMERICAN ELMAMERICAN ELMAMERICAN ELMAMERICAN ELM203204205206207208209210211213214215216217218219220221222223224225226227228229230231232233234235236237238239240241242243244245246247BLACK WALNUT 19.0 GOOD212KENTUCKY COFFEETREE 21.0 FAIREASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINEBOXELDEREASTERN WHITE PINEEASTERN WHITE PINEEASTERN WHITE PINETREES TO BE REMOVED (FAIR & GOOD)1,063"SUMMARY - TREE REMOVAL311 - BUFFERS / RESERVE A & C (2.5" CAL AVE.)53 - STREET TREES (3.5" CAL)40 - CENTRAL RESERVE (2.5" CAL AVE)*TREES IN POOR CONDITION WILL NOT BE REPLACED.185.5"777.5"100"REMOVAL TOTAL: 324REMOVAL TOTAL: 164REMOVAL TOTAL: 180REMOVAL TOTAL: 32174*PEAR TREES IN POOR CONDITION WILL NOT BE REPLACED.SUMMARY - TREE REPLACEMENT1,063"17.4%73.2%9.4% 6321131914161718478910111252015TREES TO BE REMOVED FORINFRASTRUCTUREAREAS TO BE AUGMENTED WITH ADDITIONALPLANTINGS THROUGH REFORESTATION /REPLACEMENT PROGRAM. FINAL PLANTLOCATIONS TO BE DETERMINED DURING FINALDEVELOPMENT PLAN PROCESS TO ENSURECOORDINATION WITH SITE INFRASTRUCTUREAND GRADING. FINAL LANDSCAPE PLAN TO BECOORDINATED WITH CITY FORESTER.TREE PRESERVATIONAREA (TYP.)AREAS TO BE AUGMENTED WITH ADDITIONALPLANTINGS THROUGH REFORESTATION /REPLACEMENT PROGRAM. FINAL PLANTLOCATIONS TO BE DETERMINED DURING FINALDEVELOPMENT PLAN PROCESS TO ENSURECOORDINATION WITH SITE INFRASTRUCTUREAND GRADING. FINAL LANDSCAPE PLAN TO BECOORDINATED WITH CITY FORESTER.TREE PRESERVATIONAREA (TYP.)EXISTING TREE TOREMAIN (TYP.)TREES TO BE REMOVED FORINFRASTRUCTUREPROPOSED STREETTREE PLANTINGS (TYP.)BIRCH GROVE INCENTRAL COURT150'50'25'0'SheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer11LANDSCAPE / TREEREPLACEMENT PLAN24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25NORTHLEGENDNEW DECIDUOUS SHADE TREE - SIZES TO VARYEXISTING TREE - TREE PRESERVATION ZONEEXISTING TREE - TREE SURVEY INDEXPLANT LIST - TREE REPLACEMENTKEYCOMMON NAMEBOTANICAL NAMESIZECOND.TREESCER EASTERN REDBUDCERCIS CANADENSISB&BCEL AMERICAN HACKBERRYCELTIS OCCIDENTALISREMARKS--B&BNYS BLACK GUMNYSSA SYLVATICA-B&BB&BACER FREEMANII VARIETIES FREEMAN RED MAPLE 1"-3.5" CALAFMB&BQBI SWAMP WHITE OAKQUERCUS BICOLOR--PLA PLATANUS OCCIDENTALISB&B1"-2.5" CAL-B&BQUERCUS RUBRA RED OAK 1"-2.5" CALQUE-B&BACER RUBRUM 'OCTOBER GLORY' OCTOBER GLORY RED MAPLE 1"-3.5" CALAOG-B&BBET PAPERBARK BIRCHBETULA PAPYRIFERA-ULM ULMUS AMERICANAB&B1"-3.5" CAL-AMERICAN SYCAMORE1"-2.5" CAL10' HT.1"-2.5" CAL1"-3.5" CAL1"-2" CALAMERICAN ELMTREE PROTECTION FENCING 1N.T.S.EXISTING GROUNDPROTECTIVE FENCINGTO EDGE OF TREECRITICAL ROOT ZONE,ENCIRCLING THE TREEELEVATION*FINAL PLANT LIST TO BE COORDINATED WITH CITY FORESTER FOR VARIETIES AND SIZES. PRIVATE REALMxOUTDOOR DININGxGARDENSxUSER PRIVACYxOPEN LAWNSxREAR LANDSCAPE DRAINAGEPUBLIC REALMxARRIVAL SPACExENTRY GARDENxINVITINGxARCHITECTURAL FACADExPOSSIBLE AUXILIARY STRUCTUREPRIVATE REALMxOUTDOOR DININGxGARDENS & POOLxVIEWS TO WOODSxDRAINAGE TO STREAMPUBLIC REALMxARRIVAL SPACExENTRY GARDENxINVITINGxARCHITECTURAL FACADEEAST COURTLOT SIZE: 12,634 SFBUILDABLE AREA: 7,130 SFMAX BUILD DEPTH: 98'LOT COVERAGE: 44%MAIN DRIVE LOT SIZE: 9,801 SFBUILDABLE AREA: 5,4800 SFMAX BUILD DEPTH: 80'LOT COVERAGE: 43%BILLINGSLEY RUN (OPENSPACE)FLOOD LIMITSETBACK MAIN DRIVESETBACK NOTE:ALL SETBACKS & RESTRICTIONSARE AS DESCRIBED IN THEDEVELOPMENT STANDARDS.NOTE:ALL IMAGES SHOWN ARE FORPROPOSED CHARACTERCOMMUNICATIONS ONLY. ALLHOMES ARE TO BE CUSTOM ANDBUILT CONDITIONS WILL VARY.SheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer12TYPICAL LOTS STREET ELEVATION STREET SECTION24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25SCALE: NTSLOT TYPE EXHIBIT (SMALL LOT #19) SCALE: NTSLOT TYPE EXHIBIT (WALK-OUT LOT #12) DEVELOPMENT CHARACTER IMAGERY 40' ROW24' STREET WIDTH - FACE TO FACEC5'15' SETBACKLDeveloper-Proposed Street Section5'BUILD-TO15' SETBACK5'BUILD-TOCURBCURB90' BUILDING TO BUILDING24' STREET WIDTH - FACE TO FACEC6'-6"15' SETBACKLCity-Proposed Street Section5'BUILD-TO15' SETBACK5'BUILD-TOCURBCURB6'6'-6"6'SheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer13TYPICAL LOTS STREET ELEVATION STREET SECTION24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25SCALE: NTSTYPICAL STREET ELEVATION SCALE: 1/8" = 1'-0"STREET SECTIONSBUILDING EXTERIOR MATERIALS - EXAMPLESNOTE:ALL SETBACKS & RESTRICTIONS ARE AS DESCRIBEDIN THE DEVELOPMENT STANDARDS.NOTE:ALL IMAGES SHOWN ARE FOR PROPOSED CHARACTERCOMMUNICATIONS ONLY. ALL HOMES ARE TO BECUSTOM AND BUILT CONDITIONS WILL VARY. ENTRYDRIVEWAY6' SETBACK40' SETBACKPRIMARY STRUCTURE20'SETBACK25' MIN.PRIVATEOPEN SPACE20'SETBACKTERRACEGARAGEBUILDINGENVELOPE+/-5000 SFENTRYBUILDING ENVELOPE2 STORY+/-5000 SFGARAGETERRACE15'SETBACKLOWERTERRACE25' MIN. PRIVA T E OPEN S P A C E 40' SET B A C K PRIMAR Y S T R U C T U R E 20' SETBAC KDRIVEWAYENTRYWALK 20'SETBACKSheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer14LOT LAYOUTDIAGRAMS /CHARACTER IMAGES24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.25SCALE: 1" = 20'LOT #2 LAYOUT DIAGRAMCHARACTER IMAGERYSCALE: 1" = 20'LOT #5 LAYOUT DIAGRAMNORTHNORTHNOTE:PLAN DIAGRAMS ARE FOR INFORMATION ONLY TOGRAPHICALLY DEPICT TYPICAL LOT RESTRICTIONS,POSSIBLE PLACEMENT OF STRUCTURES (BUILDINGENVELOPE) AND SUPPORTING SITE FEATURE. ALL HOMESARE TO BE CUSTOM DESIGNED TO CONFORM TO THECONDITIONS, TOPOGRAPHY, CONFIGURATION ANDRESTRICTIONS OF ITS LOT. WEST WOODxSTORMWATERxLANDSCAPED BASINxOVERLOOKxCASUAL SEATINGEXISTING TREESMAINTENANCEPATHEXISTING TREESTERMINUS FEATURECENTRAL COURTxSTONE ENTRIESxGANG MAILBOXxWHITE BIRCH GROVExOPEN LAWNEXISTING TREESCOMMUNITY GATHERING : SEATING AREABIRCH GROVESALLEE : PEDESTRIAN PATH5' PERIMETER WALKMAILBOXSheetSheet TitleDatesRevisionsProject NumberProject ManagerDrawnCheckedClientProjectArchitectPRELIMINARYNOT FOR CONSTRUCTIONCivil Engineer / SurveyorStructural Engineer15WEST WOOD /CENTRAL COURTENLARGEMENT24-0002.0CMVCMVBPKBright Road Reserve4338 Bright RoadDublin, OH 430824338 Bright RoadPartners, LLC8824 Dunsinane DriveDublin, OH 4301701.17.2575'30'15'0'NORTH $4+)*6 41#& 4'5'48'%QPEGRV 2NCP 4GXKGY/C[$TKIJV4QCF&WDNKP1* 1YPGT&056TWUV5CNN[5*CKODCWIJ6TWUVGG%CRG9TCVJ&TKXG&WDNKP1JKQUJCKODCWIJ"[CJQQEQOÄÄ&GXGNQRGT$TKIJV4QCF2CTVPGTU..%/CPCIKPI2CTVPGT9KNNKCO*#FCOU&WPUKPCPG&TKXG&WDNKP1JKQYJCFCOU"IOCKNEQO ÄÄ 05/15/240 25 50 100 200N4338 Bright Road : Project Vicinity MapPROJECTLOCATION 05/15/240 25 50 100 200N4338 Bright Road : Development NarrativeUnique Community7KLVGHYHORSPHQWZLOOEHDXQLTXHDQGGLVWLQFWRႇHULQJZLWKLQWKH&LW\RI'XEOLQZLWKWKHFRPELQDWLRQRIDKLJKTXDOLW\VLWHDQGFXVWRPDUFKLWHFWXUHWRHQKDQFHWKDWSRVLWLRQ7KHTXLHWQDWXUHRIWKLVVHJPHQWRI%ULJKW5RDG ZHVWRIWKH+RSHZHOO(OHPHQWDU\6FKRRO DQGLWVGLVFRQQHFWLRQIURP5LYHUVLGH'ULYHIRUYHKLFXODUWUDႈFPDNHVWKLVVLWHZHOOORFDWHGIRUDKDPOHWHQFODYHRIDUFKLWHFWXUDOO\FRQWUROOHGUHVLGHQFHVFDWHULQJWRWKHHPSW\QHVWHUEX\HUDWRQHHQGRIWKHDJHFRQWLQXXPDQGWKHGXDOSURIHVVLRQDOLQFRPH\RXQJIDPLO\DWWKHRWKHUHDFKORRNLQJIRUWKHFRQYHQLHQFHVDQGDPHQLWLHVRI'XEOLQLQFOXGLQJDGMDFHQW%ULGJH3DUNUHVWDXUDQWVDQGVFKRROVSDUNVUHVSHFWLYHO\DPRQJPDQ\RWKHUVPreamble7KH&LW\RI'XEOLQKDVEHFRPHRQHRIWKH¿QHVWFRPPXQLWLHVLQWKHFRXQWU\LQZKLFKWROLYHZRUNDQGVRFLDOL]H&HQWUDO2KLRDVDZKROHLVH[SHULHQFLQJDVLJQL¿FDQWGHPDQGIRUDOOOHYHOVRIKRXVLQJDQG'XEOLQLVQRWLPPXQHWRWKHVHQHHGV7KLVGHYHORSPHQWWKRXJKPRGHVWLQVL]HORRNVWRVDWLVI\WKHGHVLUHRIPDQ\WRMRLQLQWRWKH'XEOLQFRPPXQLW\DQGWKRVHWKDWKDYHEHHQKHUHIRU\HDUVWRUHPDLQKHUHDVDYLWDOSDUWRIWKHFRPPXQLW\WKDWWKH\KHOSHGWREXLOG%ULJKW5RDG3DUWQHUV//& 'HYHORSHU SURSRVHVWRGHYHORSWKLVDFVLWHRQ%ULJKW5RDGLQ'XEOLQ2KLRZLWKDUHQRZQHGDQGZHOOUHVSHFWHGORFDOEXLOGHUSDUWQHU'HYHORSHULVSURSRVLQJDKLJKTXDOLW\3ODQQHG'HYHORSPHQWWKDWDOORZVIRU³FRQVHUYDWLRQGHVLJQ´LQNHHSLQJZLWK'XEOLQ¶VRUGLQDQFHDQGLWV1HLJKERUKRRG'HVLJQ*XLGHOLQHVDOOLQDQHႇRUWWRSUHVHUYHWKHQDWXUDOFKDUDFWHURIWKHVLWHIRUWKHEHQH¿WRIWKHIXWXUHKRPHRZQHUVDQGWKHVXUURXQGLQJQHLJKERUKRRGV7KHUHVLGHQWLDOSURGXFWLVDQWLFLSDWHGWREHDWWKHKLJKHUHQGRIWKHVLQJOHIDPLO\UHVLGHQWLDOPDUNHWLQWKLVFRPPXQLW\Community Plan Vision7KLVSURSRVDOORRNVWRHPEUDFHWKH'XEOLQUHSXWDWLRQDVDSUHPLHUFRPPXQLW\DQGEXLOGXSRQWKHIRXQGDWLRQDOHOHPHQWVRIWKH&RPPXQLW\3ODQWKURXJKDGGUHVVLQJPDQ\VSHFL¿FHOHPHQWVRIWKH³'XEOLQ&KDUDFWHU´DSSOLFDEOHWRWKLVQHLJKERUKRRGNatural FeaturesSUHVHUYDWLRQDQGFHOHEUDWLRQIRUUHVLGHQWXVHWKHVWUHDPFRUULGRURQWKHHDVWDQGwoodlot to the westRural Landscape±5HVSHFWIRUWKHFKDUDFWHURI%ULJKW5RDGDQGWKHRYHUDOOODQGVFDSHHistoric Dublin±&RQQHFWLRQWRWKH6FLRWR5LYHU WKHVLQJOHPRVWLPSRUWDQWQDWXUDOHOHPHQWWKDWIDFLOLWDWHGWKHRULJLQDOVHWWOHPHQWRI'XEOLQ DQGWKH+LVWRULF'RZQWRZQMXVWDVKRUWZDONDZD\Cultural Heritage&RQQHFWWRFHOHEUDWHWKH+RSHZHOO0RXQGWKH/HDWKHUOLSVVFXOSWXUHWKHSDUNVDQGULYHUIURQWRoadway Character and Streetscapes±3UHVHUYHWKH%ULJKW5RDGIURQWDJHFKDUDFWHUZKLOHSURYLGLQJIRULQWLPDWHLQWHULRUVWUHHWV¿QHO\DSSRLQWHGFRUULGRUVDQGDXWRFRXUWVParks, Reserves, Open Space±3UHVHUYHGVWUHDPFRUULGRUZRRGORWZRRGHGSHULPHWHUEXႇHUVUHVLGHQWLDOFRXUWVSULYDWHODQGVFDSHVEnvironmental Stewardship and Sensitivity±0LQLPL]HODQGGLVWXUEDQFHWKUX&RQVHUYDWLRQ'HVLJQQDWXUDOO\PDQDJHVWRUPZDWHUUHYHJHWDWHWKHVLWHZLWKVWULFWO\LQGLJHQRXVSODQWLQJVQuality of Life±SURYLGHIRUXQLTXHKRPHV¿QHOLYLQJVSDFHVSHFWDFXODURXWGRRUHQYLURQPHQWVHigh quality residential development±¿QHTXDOLW\PDWHULDOVVWXQQLQJH[WHULRUH[SUHVVLRQVWDLORUHGRXWGRRUSULYDWHVSDFHVDPHQLWLHVĞǀĞůŽƉŵĞŶƚEĂƌƌĂƟǀĞNeighborhood Design 7KLVSURSRVDOORRNVWRUHVSHFWWKH&RQVHUYDWLRQ'HVLJQ2UGLQDQFHDQGWKH1HLJKERUKRRGGHVLJQ*XLGHOLQHVRIWKHFLW\$VLGHQWL¿HGLQWKH&RPPXQLW\3ODQPXFKRIWKLVVLWHKDVEHHQXVHGLQWKHSDVWIRUDJULFXOWXUDODQG³UXUDOUHVLGHQWLDO´SXUSRVHVDQGDVDUHVXOWDVLJQL¿FDQWSRUWLRQKDVEHHQSUHYLRXVO\FOHDUHGDQGZDVUHFHQWO\RFFXSLHGE\DVLQJOHGZHOOLQJVLQFHGHPROLVKHG7KLVSURSRVDODVVXPHVWKDWWKHSUHYLRXVO\FOHDUHGODQGZRXOGEHXVHGIRUKRXVLQJGHYHORSPHQWLQDZD\WKDWPLQLPL]HVGLVWXUEDQFHDQGFRQVWUXFWLRQDFWLYLW\VSHDNLQJGLUHFWO\WRYHU\GH¿QLWLRQRI³VXVWDLQDELOLW\´LQGHYHORSPHQW+RPHVLWHVDUHWREHFOXVWHUHGLQVXFKDZD\WKDWWKHH[LVWLQJVWUHDPFRUULGRU %LOOLQJVOH\'LWFK LVSUHVHUYHGDQGHQKDQFHGDQGLWVVXUURXQGLQJZRRGVUHVHUYHGDVDQDWXUDO³YLOODJHSDUN´ZLWKVRIWVXUIDFHSDWKVDQGFDVXDOVHDWLQJDUHDV)XUWKHUWKH:HVWHUQ:RRGFRQVLVWLQJODUJHO\RIYROXQWHHUWUHHJURZWKZLOOIXUWKHUSURYLGHIRUFRPPXQLW\RSHQVSDFHDQGDFFRPPRGDWHWKHPDMRULW\RIVWRUPZDWHUPDQDJHPHQWQHFHVVDU\IRUWKHGHYHORSPHQW7KLVDUHD¶VQDWXUDOHQYLURQPHQWZLOOEHHQKDQFHGWKURXJKWKRXJKWIXOJUDGLQJIRUVWRUPZDWHUPDQDJHPHQWVRIWVXUIDFHWUDLOIRUUHVLGHQWGDLO\XVHUHIRUHVWDWLRQZLWKHQYLURQPHQWDOO\FRUUHFWLQGLJHQRXVSODQWVDQGDQDWXUDOL]HGODQGVFDSH*HQHURXVDQGGHQVHSHULPHWHUEXIIHUDUHDVIURPDGMDFHQWKRPHVLWHVDUHODUJHO\H[LVWLQJZLWKVWDQGVRIYDULRXVPDWXUHSODQWVDQGZLOOEHDXJPHQWHGE\QHZQDWLYHSODQWLQJV&HUWDLQRIWKHVHUHVHUYHVDUHWREHSODFHGLQSHUSHWXDOODQGVFDSHHDVHPHQWVWKDWDOORZIRUFRQQHFWLRQWRWKHVWUHHWZDONZD\V\VWHP%LOOLQJVOH\'LWFKFRUULGRUDQGWKH:HVWHUQ:RRGIRUVWUROOLQJGRJZDONLQJUHOD[LQJ$GGLWLRQDOO\WKLVFDVXDOVRIWVXUIDFHSDWKV\VWHPZLOOSURYLGHIRUGLUHFWSHGHVWULDQFRQQHFWLRQWRWKH+ROGHU:ULJKW(DUWKZRUNVDQGSXEOLFSDUNDFFHVVDORQJ%ULJKW5RDGWR5LYHUVLGH'ULYHDQGWKHLQFUHGLEOHSDUNVDQGUHWDLORႇHULQJVWKHUH1RQFRQYHQWLRQDOVWUHHWVGHYHORSHGDUHFRQVLGHUHGPRUHDVPHZVDQGOHVVDV³VXEGLYLVLRQ´VWUHHWVZLWKDWWHQWLRQWRJXWWHUVFXUEGHWDLOVDQGVLGHZDONV&HQWUDOL]HGDXWRFRXUWVFOXVWHULQJKRPHVLWHGULYHZD\HQWULHVDUHPRUH³SLD]]D´WKDQ³FXOGHVDF´SRVVLEO\ZLWKVSHFLDOW\SDYHPHQWHGJLQJ/XVKZHOOWDLORUHGODQGVFDSHIRUWKH³FLYLF´VLGHRIKRPHIURQWVHQWU\GULYHVZDONVVXUURXQGHGE\QDWXUDOL]HG³QDWLYH´JUHHQDUHDVRIVWUHDPFRUULGRU:HVWHUQ:RRGEXႇHUVGUDLQDJHZD\V7KLVFRPPXQLW\ORRNVWREHDQLPSRUWDQWSDUWRIWKH'XEOLQFRPPXQLW\ZLWKDZHOFRPLQJLQFOXVLYHFRQQHFWLRQWRWKHQHLJKERUKRRGWKDWEOHQGVZHOOZLWKWKHVXUURXQGLQJFRPPXQLW\Development Theme$VGHVFULEHGDERYHLQGLႇHUHQWODQJXDJHWKLVQHZFRPPXQLW\LVEHLQJSODQQHGWR³¿W´WKHVLWHDV\RXVHHLWWRGD\&LUFXODWLRQQHWZRUNDQGKRPHVLWHVDUHSODQQHGZLWKUHVSHFWRQWKHH[LVWLQJWRSRJUDSK\ZLWKPLQLPDOHDUWKZRUNDQWLFLSDWHG+RPHVZLOO³VLWXSRQ´WKHLUVLWHZLWKRQO\PLQLPDOORFDOJUDGLQJDQGWDNHDGYDQWDJHRIVORSLQJJUDGHWRH[SRVHORZHUOHYHOOLYLQJVSDFHVZKHUHSUDFWLFDO&RQVLGHUDEOHSHULPHWHUDQGJURXSLQJVRIVWDQGLQJYHJHWDWLRQDUHWREHSUHVHUYHGHQKDQFHGWRFUHDWHD³SDUNOLNH´FKDUDFWHURIWKHRYHUDOOFRPPXQLW\7KHDUFKLWHFWXUHRIWKHVLWHLVSUHVHQWO\WKRXJKWWREHFODVVLF³QRXYHDXWUDGLWLRQDO´RIKLJKO\GHWDLOHGHOHYDWLRQVDQGURRIVEXLOGLQJHOHPHQWV URRIPHWDOFKLPQH\VGRRUVZDOOGHWDLOV LQDPL[RIPDWHULDOV VWRQHVWXFFREULFNERDUGDQGEDWRQODSVODWHHWF DOODVSDUWRID³WKHPHG´\HWHFOHFWLFPL[RIKRPHVFRPPRQE\WKHLUUHODWLYHVL]HVURRISLWFKPL[RIPDVVLQJ JDUDJHVWRERG\WRVLGHURRPV GH¿QHGHQWU\ZLWKZRRGHG%ULJKW5RDGIURQWDJH,QGLYLGXDOKRPHVLWHPD\LQFOXGHJDUGHQVSRVVLEOHSRROHQWHUWDLQPHQWWHUUDFHIRUPDOHQWU\ZD\JDUGHQVKHGFDEDQDDVPD\EHGHVLUHGE\HQGEX\HU,WLVIXUWKHUDVVXPHGWKDWWKLVGHYHORSPHQWZLOOEHVROGIHHVLPSOHZLWKSXEOLFURDGV2SHQVSDFHVDQGODQGVFDSHHDVHPHQWVDUHWREHFRQWUROOHGDQGHQIRUFHGE\DQDVVRFLDWLRQZLWKDOOWKDWLQIHUVIURPDPDLQWHQDQFHRSHUDWLRQVDQGRZQHUVKLSVWDQGSRLQW7KHDVVRFLDWLRQLVWREHHVWDEOLVKHGZLWKDOWKHQHFHVVDU\SRZHUVWRHQIRUFHSROLFLHVWREHVHWIRUWKLQJHQHUDOWHUPVLQIXWXUHVWDJHVRIWKLVSODQDSSURYDODQGWKHUHE\HQVXUHWKHORQJWHUPTXDOLW\GHVFULEHGKHUHLQ,WZLOOEHFRPHDGHVWLQDWLRQORFDWLRQWKURXJKLWVXQLTXHQHVVDQGFDUU\DPRQLNHUWKDWLVUHFRJQL]HGLQWKHFRPPXQLW\7KLVFRPPXQLW\KDVDORQJDQGULFKKLVWRU\DQGFXOWXUHGDWLQJEDFNIDUEH\RQG(XURSHDQVHWWOHPHQWRIWKHDUHD7KHGHYHORSPHQW¶VIXWXUHQDPHLVWREHDXWKHQWLFDOO\UHPLQLVFHQWRIWKDWPedestrian Realm±6SHFLDOW\SDYHGVLGHZDONVDUHWREHFRQVLGHUHGDQGZDONVWREHSURYLGHGIRULQRQHVLGHRIHDFKVWUHHWSURYLGLQJIRUSHGHVWULDQFRQQHFWLRQWRIURPHYHU\KRPHVLWHDQGPDLOIDFLOLW\7KH&HQWUDO&RXUWZLOOQRWLQFOXGHDZDONZD\VLQFHLWVHQWLUHLQVWDOODWLRQLVLQWHQGHGWREHSHGHVWULDQDFFRPPRGDWLQJJLYHQLWVODFNRIH[WHQVLYHYHKLFOHWUDႈF)XUWKHUWKLVFRXUWLVSURSRVHGWREHFXUEOHVVRQLWVLQVLGHHGJHDOORZLQJIRUGLUHFWGUDLQLQJLQWRLWVVWRUPZDWHUPDQDJHPHQWGHYLVH$GGLWLRQDOO\WKLVÀXVKHGJHLVSURSRVHGWREHVSHFLDOW\SDYHGIRUYLVLWRUSDUNLQJVWUHHWVLGHDQGGH¿QHVE\ORZXSOLJKWHGPDVRQU\SLHUVDQGVWUHHWWUHHSODQWLQJV7KHFHQWHURIWKH&RXUWLVWREHHQJLQHHUHGWRFDSWXUHKROGVWRUPZDWHUIROORZLQJUDLQHYHQWV\HWXVDEOHRSHQVSDFHLQGU\FRQGLWLRQV7KH(DVW&RXUWLVSURSRVHGWREHHQWLUHO\SDYHGZLWK³SRURXV´SDYHUV\VWHPDOORZLQJIRUSRVVLEOHVXEVXUIDFHVWRUPZDWHUVWRUDJHDQGFRQWUROOHGGLVFKDUJH,WWRRLVFRQVLGHUHGIRUXSOLJKWHGPDVRQU\SLHUVDQGVWUHHWWUHHSODQWLQJVIRUGH¿QLWLRQSemi-Private Space±WZRPDMRUVHPLSULYDWHRSHQVSDFHVDUHSURSRVHGZLWKLQWKLVGHYHORSPHQW)LUVWWKH%LOOLQJVOH\5XQDUHD7KHFUHHNEHGLWVHOIDQGDOOH[LVWLQJZRRGHGHDVWRILWDUHWRUHPDLQLQSURWHFWHGUHVHUYHIRUP,PSURYHPHQWVDUHDVIROORZV OLPLWHGWRVRIWVXUIDFHWUDLOÀDWURFNFURVVLQJVIRUIRRWWUDႈF FDVXDOVHDWLQJDUHDVIXUQLVKLQJVLQVHOHFWDUHDVDQGFRQQHFWLRQWRWKHSXEOLFGRPDLQRIWKH VWUHHWZDONV\VWHPVWKUXWKH(DVW&RXUW :LWKWKHSRVVLEOHH[FHSWLRQRIWUHHVLQGDQJHURXVFRQGLWLRQDQGVXEMHFWWRGDPDJLQJIDOOVWKLV ZRRGORWLVWRUHPDLQDVLVDQGSURYLGHIRUWKHQDWXUDOÀRUDDQGIDXQDWKDWLVFXUUHQWO\WKHUH6HFRQGLVWKH:HVW:RRG7KRXJKFRQVLVWLQJRIYROXQWHHUWUHHJURZWKRIDOHVVHUTXDOLW\WKDQWKH%LOOLQJVOH\5XQDUHDWKHSHULPHWHUWUHHDQGJURXQGFRYHULVWRUHPDLQLQWKLVDUHD%HLQJDWWKHORZHUHQGRIWKHZDWHUVKHGRIWKHVLWHSRUWLRQVRIWKLVDUHDDUHWREHUHJUDGLQJDQGJUHDWO\HQKDQFHGWR 3URYLGHIRUQHHGHGVWRUPZDWHUPDQDJHPHQW &RQWUROGRZQVWUHDPGUDLQDJHGLVFKDUJH 6HOHFWLYHUHPRYDORIFHUWDLQSRRUTXDOLW\WUHHV (QKDQFHWKHODQGVFDSHWKUXDQLQWHQWLRQDOSODQWLQJGHVLJQLQVWDOODWLRQIRUWKHFUHDWLRQRID PRUHPDQLFXUHGDQGXVDEOHRXWGRRUVSDFHIRUWKHUHVLGHQWVDQGQHLJKERUVDOLNH7KHVWRUP ZDWHUVWRUDJHLVWREHDFFRPPRGDWHGLQDSURSHUO\DQGVHQVLWLYHO\JUDGHG³GU\EDVLQ´ZLWKZHOO VHOHFWHGJURXQGFRYHUVWKDWDOORZIRUWKHXVDJHRIWKLVEDVLQLQLWVGU\FRQGLWLRQV ,QWHQWLRQDOO\URXWHDVRIWVXUIDFHWUDLOWRDQGWKURXJKWKLVVSDFHZLWKFRQQHFWLRQVWRWKHGHYHO RSPHQWWRWLVHDVWWKURXJKODQGVFDSHHDVHPHQWVFRQWDLQLQJWUDLOFRQQHFWLRQVWRWKHVRXWKZHVW WR%ULJKW5RDGSXEOLFSDUN%ULGJH6WUHHWULYHUIURQWDQGVXUURXQGLQJQHLJKERUKRRGDevelopment Areas7KLVGHYHORSPHQWZLOOEHDXQLTXHDQGGLVWLQFWRႇHULQJZLWKLQWKH&LW\RI'XEOLQZLWKWKHFRPELQDWLRQRIDKLJKTXDOLW\VLWHDQGFXVWRPDUFKLWHFWXUHWRHQKDQFHWKDWSRVLWLRQ7KHTXLHWQDWXUHRIWKLVVHJPHQWRI%ULJKW5RDG ZHVWRIWKH+RSHZHOO(OHPHQWDU\6FKRRO DQGLWVGLVFRQQHFWLRQIURP5LYHUVLGH'ULYHIRUYHKLFXODUWUDႈFPDNHVWKLVVLWHZHOOORFDWHGIRUDKDPOHWHQFODYHRIDUFKLWHFWXUDOO\FRQWUROOHGUHVLGHQFHVFDWHULQJWRWKHHPSW\QHVWHUEX\HUDWRQHHQGRIWKHDJHFRQWLQXXPDQGWKHGXDOSURIHVVLRQDOLQFRPH\RXQJIDPLO\DWWKHRWKHUHDFKORRNLQJIRUWKHFRQYHQLHQFHVDQGDPHQLWLHVRI'XEOLQLQFOXGLQJDGMDFHQW%ULGJH3DUNUHVWDXUDQWVDQGVFKRROVSDUNVUHVSHFWLYHO\DPRQJPDQ\RWKHUVPublic RealmStreetscape±6WUHHW5LJKWRI:D\DUHFXUUHQWO\SURSRVHGWREH¶IRUSULPDU\VWUHHWDFFHVVLQJ%ULJKW5RDGDQG¶IRUWKHVHFRQGDU\ORFDOVWUHHW$OOWXUQLQJUDGLLDUHWREHLQFRPSOLDQFHZLWK(QJLQHHULQJDQG)LUH&KLHIVWDQGDUGV7KHHQWLUHV\VWHPLVSURSRVHGWRKROGDQLQWLPDWHIHHOLQJZLWKLQGLJHQRXVVWUHHWWUHHVPDVRQU\SLHUVIRUVSDFHGH¿QLWLRQFRRUGLQDWHGVLJQDJHDQGSRVVLEOHVSHFLDOW\FXUEJXWWHUGHWDLODVDSSURYHGE\WKH&LW\(QJLQHHU3XEOLFRSHQVSDFHFRQQHFWLRQVDUHWREHLGHQWL¿HGDFFHQWXDWHGE\PRUHGHWDLOHGODQGVFDSLQJDWWKHHQWU\SRLQWVIURPWKHSXEOLFGRPDLQ0RVWO\PRZQODZQWUHHHGJHLVDQWLFLSDWHGZLWKWKHSRVVLELOLW\RIRWKHUORZVKUXEVJURXQGFRYHUVÀRZHULQJSODQWVLQDUHDVRIVSHFLDOUHFRJQLWLRQ LHLQWHUVHFWLRQVFRXUWHGJHV 7KLVVWUHHWV\VWHPFRQWDLQVWZRVLJQL¿FDQWVSDFHVLQFOXGLQJWKH&HQWUDO&RXUWRQWKHZHVWDQGWKH(DVW&RXUWRQWKHHDVW%RWKDUHWRDFFRPPRGDWHYHKLFOHFLUFXODWLRQDQGKRPHVLWHDFFHVVEXWDUHDOVRWREHGHYHORSHGDVPHDQLQJIXOSXEOLFRSHQVSDFHZKLOHVHUYLQJD³VKRZFDVHG´IXQFWLRQDVDSDUWRIWKHVWRUPGUDLQDJHV\VWHP$VLQJOHSRLQWRIHQWU\LVSURSRVHGDW%ULJKW5RDGQRPLQDOO\DWWKHFXUUHQWGULYHZD\HQWUDQFHEXWZLOOFUHDWHDIXOO\IXQFWLRQDOFURVVLQWHUVHFWLRQZLWK*UDQGHH&OLႇV'ULYH7KHH[LVWLQJVWDQGRIHYHUJUHHQWUHHVLVSURSRVHGWRUHPDLQDQGWREHHQKDQFHGWKURXJKDGGLWLRQDOSODQWLQJVDQGIURQWDJHERDUGUDLOIHQFHLVWREHUHSDLUHGRUUHSODFHGDOOZLWKWKHLQWHQWRISURWHFWLQJUHLQIRUFLQJWKHFKDUDFWHURIWKLVSRUWLRQRI%ULJKW5RDG7KHHQWU\VWUHHWLVWRKDYHVXႈFLHQWDQGVDIHVLJKWOLQHVDQGWXUQLQJUDGLLDOOLQNHHSLQJZLWK(QJLQHHULQJVWDQGDUGV7KHHQWU\LVQRWWKRXJKWWREHFRQYHQWLRQDOO\GHVLJQHGZLWKVLJQSDQHOVDQGH[RWLFODQGVFDSHEXWPRUHDXWKHQWLFDOO\GH¿QHGEXWWKHDUFKLWHFWXUHRIWKHWZR³JDWHZD\´ORWVWKURXJKHOHPHQWVRIWKHKRXVHDUFKLWHFWXUHDVLOOXVWUDWHGKHUHLQ7KLVDUUDQJHPHQWLVPHDQWWRSRUWUD\DVHQVHRIVW\OHWRWKHFRPPXQLW\E\VKRZFDVLQJWKHGHYHORSPHQWFKDUDFWHUVRLPPHGLDWHO\\HWSURYLGLQJDVHQVHRIZHOFRPHWRWKHSXEOLFArchitecture6HH$UFKLWHFWXUDOFKDUDFWHUSODQDQGLPDJHVKHUHLQZKLFKVHUYHWRFRPPXQLFDWHWKHFXUUHQWWKLQNLQJRIWKHRYHUDOOFKDUDFWHURIWKHGHYHORSPHQW:KLOHWKLVGHYHORSPHQWZLOOEH³WKHPHG´DQGUHFRJQL]HGDVDKROLVWLFSODFHLVZLOOQRWEHPRQRFKURPDWLFLQIURPDQGFRORU7KHFRPPRQWKUHDGZLWKEHWKHTXDOLW\RIWKHGHVLJQHGDUFKLWHFWXUHWKHVLPLODULW\LQURRISLWFKDSDOHWWHRIKLJKTXDOLW\PDWHULDOVEXWHDFKKRPHEHLQJGLVWLQJXLVKHGE\LWVRZQPDVVLQJFRPSRVLWLRQPL[WXUHRIPDWHULDOW\SHVDQGSXEOLFUHDOPODQGVFDSH*DUDJHVDUHPHDQWWREHVLGHORDGLQJIRUVDNHRIGLPLQLVKLQJWKHYLVXDOLPSDFWRIWKHLUGRRUVEXWDQFLOODU\³WKLUGFDU´JDUDJHVPD\EHSURYLGHGEXWXWLOL]LQJWKHSDOHWWHRIKRXVHPDWHULDOVDQGFRPSOHPHQWDU\PDVVLQJZLWKGRRUVVHWEDFNIURPWKHKRPHIDFHVKRXOGWKH\EH³IURQWORDGHG´ 05/15/240 25 50 100 200N4338 Bright Road : Development Narrative (cont.)ĞǀĞůŽƉŵĞŶƚEĂƌƌĂƟǀĞ;ĐŽŶƚ͘ͿOpen Space FrameworkSite Analysis/Existing Development Inventory7KHH[LVWLQJVLWHFRQVLVWVRIWZRVHSDUDWHSDUFHOVERWKWRWDOLQJDFUHV7KHVLWHLVERXQGRQWKHHDVWE\WKH%LOOLQJVOH\5XQDQGWKHZRRGHGDUHDODUJHO\WRWKHHDVWRIWKDWZDWHUFRXUVH7KHZHVWLVERXQGE\DYROXQWHHUJURZWKZRRGVWKDWFRQWDLQVWKHGUDLQDJHVZDOHWKDWGUDLQVWKHPDMRUZHVWHUQôRIWKHVLWH7KHPDMRULW\RIWKHVLWHDQGWKDWDUHDSURSRVHGIRUGHYHORSPHQWLVWKHIRUPHUVLWHRIDVLQJOHUHVLGHQFHDQGDVZLPPLQJSRROERWKVLQFHGHPROLVKHG$VPDOOJDUDJHVWUXFWXUHLVSUHVHQWO\WKHRQO\VWUXFWXUHWKDWH[LVWVRQVLWHLVLQSRRUFRQGLWLRQDQGLVWREHGHPROLVKHG7KHVXSSRUWLQJGULYHZD\WRWKHIRUPHUUHVLGHQFHLVDOVRLQSRRUVKDSHDQGLVWREHGHPROLVKHG7KHFOHDUHGVLWHLVWKRXJKWWRKDYHEHHQSUHYLRXVO\FXOWLYDWHGEXWLQLWVPRUHUHFHQWSDVWZDVPRZQODZQDQGVHUYHGDVWKH\DUGVSDFHIRUWKHUHVLGHQFH7KLVFOHDUHGDUHDLVWREHXVHGIRUKRPHVLWHGHYHORSPHQW7KHWRSRJUDSK\RIWKHVLWHLVVOLJKWO\UROOLQJDVLWV¶HDVWDQGZHVWHGJHVDQGWKHVLWHOD\RXWUHÀHFWVWKLVOD\RIWKHODQG7KHURDGZD\V\VWHPLVSURSRVHGWROD\ODUJHO\³DWJUDGH´ZLWKYHU\OLWWOHHDUWKZRUNQHHGHG7KHKRPHVLWHVDUHQRWDQWLFLSDWHGIRURYHUORWJUDGLQJ LHFOHDULQJJUXEELQJHDUWKPRYLQJHWF EXWZLOOEHGHYHORSHGJUDGHGLQGLYLGXDOO\WRLQVXUHVWUXFWXUHSODFHPHQWLQDOOGLPHQVLRQVDQGSURSHUGUDLQDJHRIWKHVLWHV:KDWH[LVWLQJWUHHVWKDWH[LVWLQWKLVFOHDUHGDUHDDQGWKDWDUHLQHVWDEOLVKHG³JRRG´FRQGLWLRQZLOOEHFRQVLGHUHGLQEXLOGLQJSODFHPHQWRULHQWDWLRQDQGJUDGLQJLQDQHႇRUWWRSUHVHUYHWKHPPrivate RealmSetbacks)URQW<DUGVHWEDFNVDUHVHWDW¶¶PLQLPXPGHSHQGHQWRQVWUHHWORFDWLRQ SULPDU\RUVHFRQGDU\ &RUQHUORWVDUHWRDVVXPHWKHIURQW\DUGVHWEDFNVRIHDFKRIWKHLUDGMDFHQWVWUHHWV ¶VHWEDFNIRU5:DQG¶VHWEDFNIRU¶5: 6LGH<DUGVHWEDFNVDUH¶PLQLPXPZLWKUHDU\DUGVDW¶/RWVRQWKH³SHULPHWHU´RIWKHVLWHDGMDFHQWWRVXUURXQGLQJH[LVWLQJQHLJKERUKRRGVDUHWRKDYHDGHVFULEHGDQGSURWHFWHGQREXLOGODQGVFDSHHDVHPHQWWKDWSURWHFWVWKHH[LVWLQJSODQWPDWHULDODOORZVVXႈFLHQWVSDFHWRDXJPHQWWKDWSODQWLQJ]RQHDQGUHVWULFWVDQ\KRPHRZQHUIURPDGYHUVHO\DႇHFWLQJWKLV]RQHDOOIRUVDNHRISULYDF\IRUUHVLGHQWVRQ%27+VLGHVRIWKHSURSHUW\OLQHDQGWUHHSUHVHUYDWLRQ7KHSURWHFWLRQRIWKHVHHDVHPHQWVDUHWREHHQIRUFHGE\WKH+2$DQGHVWDEOLVKHGWKURXJKODQGWLWOHEntry and Arrival$OOKRPHVDUHWRDGGUHVVWKHLUIURQWDJHVWUHHWFRXUWZLWKSURPLQHQFH'ULYHZD\DFFHVVWRJDUDJHVDUHQRWWRGRPLQDWHWKHFKDUDFWHURIWKLVVWDWHPHQWEXWZLOOSURYLGHWKDWDFFHVVZD\IRUUHVLGHQWVDQGYLVLWRUVWRHQWHUWKHKRPHVLWHVLQDQLQWHQWLRQDOZD\ZLWKSURSHUGHWDLOLQJRIWKLVPRUHSXEOLFSRUWLRQRIWKHGULYHDQGSURYLGHIRUDQDWWUDFWLYHDQGPHDQLQJIXOZDONZD\FRQQHFWLRQWRWKHKRPHHQWU\(DFKKRPHVLWHZLOOKDYHDZHOOGHWDLOHGIURQW\DUGZLWKHQWU\JDUGHQWKDWGH¿QHVWKHVHPLSULYDWHVSDFHRIWKH\DUGWKURXJKSODQWLQJVZDOOVSLHUVIHQFLQJVHJPHQWVDQGRWKHUGHYLVHGWRDGGWRWKHFKDUDFWHURIWKHKRPHDOOLQNHHSLQJZLWKWKHPDWHULDOVGHWDLOLQJRIWKDWKRPHPrivate realm5HDU\DUGVDQGDSSURSULDWHSRUWLRQVRIFHUWDLQVLGH\DUGVDUHPHDQWWREHDQH[WHQVLRQRIWKHLQWHULRU³OLYLQJVSDFH´RIWKHKRPHV,WLVHQYLVLRQHGWKDWHDFKKRPHZLOOKDYHZHOODUWLFXODWHGRXWGRRUWHUUDFHGLQLQJVSDFHJDWKHULQJDUHDVZLWKSRVVLEOHSRRODQGRUVSDDUFKLWHFWXUDOO\FRUUHFWRYHUKHDGVWUXFWXUHVVXFKDVWUHOOLVHVRUSHUJRODV0DQLFXUHGODZQDQGJDUGHQV IRUPDOFXWWLQJ9HJHWDEOHKHUE DUHDOVRDQWLFLSDWHG&HUWDLQ³SHULPHWHU´ORWVZLOOWDNHDGYDQWDJHRIWKHWRSRJUDSK\RIWKHVLWHDQGWKHQDWXUDOIHDWXUHVLQ³EOHQGLQJ´WKHVH\DUGVSDFHVLQWRWKLVH[LVWLQJHQYLURQPHQWZLWKRXWWKHFRQYHQWLRQDO³EDFN\DUG´IHHO$X[LOLDU\VWUXFWXUHVPD\DOVREHFRQVLGHUHGDOOZLWKLQNHHSLQJRIVHWEDFNVDQGDUFKLWHFWXUDOFKDUDFWHURIWKHKRPHIRUFDEDQDSRROKRXVHGLQLQJJD]HERVHFRQGDU\JDUDJHGHSHQGLQJRQWKHGHVLUHVRIWKHLQGLYLGXDOKRPHRZQHULot Coverage6HH&RQFHSWXDO/RW3ODQ7KHVHORWVDUHFODVVL¿HGDV³0DQRUORWV´DVGHVFULEHGLQWKH1HLJKERUKRRG'HVLJQ*XLGHOLQHV1RORWLVWRPRUHWKDQFRYHUDJHWKURXJKRXWWKHGHYHORSPHQWZLWKPRVWORWVEHLQJFRQVLGHUDEO\OHVVGXHWRORWVL]HWRSRJUDSK\DQGODQGVFDSHHDVHPHQWV7KHLQGLYLGXDOORWFRQ¿JXUDWLRQVDUHODUJHO\LQÀXHQFHGE\WKLVWRSRJUDSK\DQGQDWXUDOIHDWXUHV6HWEDFNVDUHLQNHHSLQJZLWKWKHPLQLPXPVVWDWHGKHUHLQKRZHYHUHDFKKRPHLVWREHVSHFL¿FDOO\VLWHGDQGDUFKLWHFWXUDOPDVVLQJPDWHULDOVRULHQWDWLRQHWFWREHVWULFWO\FRQWUROOHGE\WKHEXLOGHU/RWVZLOOQRWEHVROGDV³EODQNV´DVLQFRQYHQWLRQDOVXEGLYLVLRQVEXWZLOOEHVROGZLWKKRPHVRQO\DOOFXVWRPEXLOWWRUHÀHFW2ZQHU¶VSUHIHUHQFHVDQGVLWHGLQFRPSRVLWLRQZLWKWKHVXUURXQGLQJVQHLJKERULQJKRPHVExisting Zoning and Land Use&XUUHQWO\WKLVSURMHFWVLWHLV]RQHG5DQGWKHSURSRVHGUH]RQLQJLVWR3ODQQHG'HYHORSPHQW&XUUHQWO\WKLVVLWHLVYDFDQWPRVWUHFHQWSDVWDVLQJOHUHVLGHQWXVDJH6XUURXQGLQJDUHDVDUHUHVLGHQWLDOXVHV5]RQLQJZLWKWKHH[FHSWLRQRIWKHSXEOLFSDUNVRXWKRI%ULJKW5RDGDWWKH6:FRUQHURIWKLVGHYHORSPHQWVLWHExisting Vegetation Inventory6HH7UHH6XUYH\KHUHLQ7KHWUHHVXUYH\KDVEHHQIRFXVHGRQWKH:HVW$UHD :HVW:RRG DQGWKH(DVW$UHD %LOOLQJVOH\5XQDUHDZHVWRIWKHVWUHDPDQGWKHGHYHORSPHQWDUHDDWWKHFHQWHURIWKHSURMHFW &HUWDLQDUHDVKDYHQRWEHHQVXUYH\HGVLQFH12WUHHVDUHSURSRVHGWREHUHPRYHG7KRVHDUHDVLQFOXGHWKHZRRGHGSHULPHWHUDORQJ%ULJKW5RDGWKHQRUWKHUQSURSHUW\OLQHWKHVRXWKZHVWHUQ³ÀDJ´FRQQHFWLQJWR%ULJKW5RDGDQGWKHHQWLUHDUHDHDVWRI%LOOLQJVOH\5XQZKHUHQRGHYHORSPHQWLVSURSRVHG$VSUHYLRXVO\VWDWHGWKHZHVWDUHDLVODUJHO\FRPSULVHGRIYROXQWHHUJURZWKDQGRIOLPLWHGTXDOLW\2IWKHVXUYH\HGWUHHVLQWKDWDUHD WUHHVRYHU´FDOLSHUWUHHVLQWRWDOWKLVDUHD RQO\KDYHEHHQFODVVL¿HGDV³*RRG´E\WKHDUERULVW7KRVHVXUYH\HGLQWKH(DVW$UHD WUHHVRYHU´FDOLSHUWUHHVWRWDOWKLVDUHD KDYHEHHQFODVVL¿HGDV³*RRG´,QGLYLGXDOWUHHVZLWKLQWKLVGHYHORSPHQW]RQHDUHWREHFORVHO\ORFDWHGIRUVDNHRISUHVHUYDWLRQWKURXJKWKHIXUWKHUSODQQLQJVWDJHTopography and Hydrologic%LOOLQJVOH\5XQDQGLWVVXUURXQGLQJWUHHVWDQGLVWKHHDVWERXQGDU\RIWKHVLWH)ORRGZD\DQG6WUHDP&RUULGRU3URWHFWLRQ=RQHDUHVKRZQLQWKHSODQDWWDFKPHQWVKHUHLQDQGDUHWREHUHVSHFWHGUHODWLYHWREXLOGLQJSODFHPHQWDQGJUDGLQJRSHUDWLRQV7KHVLWHFRQVLVWVRIWZRZDWHUVKHGVZLWKWKHLUERXQGDU\URXJKO\DORQJWKHH[LVWLQJUHVLGHQWLDOGULYHKRZHYHU%27+ZDWHUVKHGVXOWLPDWHO\¿QGWKHPVHOYHVGUDLQLQJWRDFRPPRQRXWIDOODWWKH6FLRWR5LYHU3UHOLPLQDU\'HYHORSPHQW3ODQSKDVH(QJLQHHULQJZLOOIXUWKHUGH¿QHWKHVWRUPZDWHUPDQDJHPHQWRIWKHRYHUDOOVLWHEXWWKHFXUUHQWSURSRVDOVXJJHVWVWKDWSRUWLRQVRIWKHZHVWHUQZRRGVEHXWLOL]HGIRUWKDWPDQDJHPHQWDQGWKDWDUHDSRVWFRQVWUXFWLRQWRVHUYHDVDPHDQLQJIXOFRPPXQLW\RSHQVSDFH6HHIXUWKHUGHVFULSWLRQRIWKLVVSDFHKHUHLQTransportation & Access$FFHVVWRWKHVLWHIURPWKHSXEOLF5:LVIURPEULJKW5RDGDQGDWWKHLQWHUVHFWLRQRI%ULJKWDQG*UDQGHH&OLႇV'ULYH7KLVDFFHVVWRDQGWKURXJKWKHVLWHLVSURSRVHGWREHSXEOLF5:DQGDSSURSULDWHO\GHVLJQHGWRPHHWWKHUHTXLUHPHQWVRIWKHFLW\1RSXEOLFWUDQVLWIDFLOLWLHVH[LVWWRDQGGLUHFWO\DGMDFHQWWRWKLVVLWHExisting Public Utilities%RWKSXEOLF6DQLWDU\6HZHUDQG:DWHUV\VWHPVH[LVWDGMDFHQWWRWKHVLWHDORQJ%ULJKW5RDG7KHVHWZRV\VWHPVZLOOEHWDSSHGIRUVHUYLFHWRWKHGHYHORSPHQW7KHFDSDFLW\FRQGLWLRQDQGH[DFWORFDWLRQVDUHWREHGHWHUPLQHGLQWKH(QJLQHHULQJSKDVHIRUWKH3UHOLPLQDU\GHYHORSPHQW3ODQ2QVLWHVWRUPZDWHUPDQDJHPHQWLVWREHSURYLGHGIRUZLWKH[DFWGLVFKDUJHSRLQW V GHWHUPLQHGWKURXJKIXUWKHU(QJLQHHULQJVWXG\7KHUHLVOLPLWHGHYLGHQFHRID6WRUP6HZHULQWKH%ULJKW5RDGFRUULGRUDWWKH6:FRUQHURIWKHGHYHORSPHQWVLWHWKDWPD\VHUYHDVDFRQQHFWLRQSRLQW2QFHDJDLQLWVH[DFWORFDWLRQFRQGLWLRQDQGFDSDFLW\LVWREHGHWHUPLQHG)XUWKHUWKHZHVWZDWHUVKHGFXUUHQWO\GUDLQVWKURXJKDVZDOHFKDQQHOWRWKHZHVWDQGXOWLPDWHO\WRWKH6FLRWR5LYHU7KHIXWXUHRIWKDWFKDQQHODVDGHVLJQHGGUDLQDJHZD\IRUDOORUSRUWLRQVRIWKLVGHYHORSPHQW¶VGUDLQDJHLVWREHGHWHUPLQHGEXWDWQRWLPHZLOOH[FHVVGUDLQDJHEHLPSDUWHGWRWKHGRZQVWUHDPSURSHUWLHVHistoric & Cultural Assets:KLOHPRUHUHVHDUFKLQWRWKHKLVWRU\RIWKLVVLWHLVIRUWKFRPLQJQRLPPHGLDWHO\NQRZQKLVWRULFRUFXOWXUDOO\VLJQL¿FDQWDVSHFWVDUHNQRZQ,WLVEURDGO\XQGHUVWRRGWKDWWKLVHQWLUHDUHD ULYHUIURQWDQG'XEOLQDUHDDVDZKROH ZDVRFFXSLHGE\VXFFHVVLYHJHQHUDWLRQVRI1DWLYHSHRSOHVDQGHDUO\(XURSHDQVHWWOHUV$GGLWLRQDOXQGHUVWDQGLQJVDUHWREHGHWHUPLQHGDVWKLVSURFHVVPRYHVIRUZDUG+RZHYHUWKLVGHYHORSPHQWUHFRJQL]HVWKHVLJQL¿FDQFHRIWKHDGMDFHQWSXEOLFO\DFFHVVLEOHSDUNIDFLOLWLHVRQWKH(DUWKZRUNVSDUN6FLRWR3DUN/HDWKHUOLSV0RQXPHQWVWKDWDOODUHLQVKRUWZDONLQJGLVWDQFHWRIURPWKLVGHYHORSPHQWDQGZDONLQJWUDLOVDUHWREHSURYLGHGRQVLWHIRUWKHLUDFFHVV 171’359’PROJECT BOUNDARYPROJECT BOUNDARYPROPERTY LIN E650’3333334445555505/15/240 25 50 100 200NBRIGHT ROADBRIGHT ROAD4338 Bright Road : Existing ConditionsUTILITY INDEX'.'%64+%  5#0+6#4;5614/9#6'42HOLDER-WRIGHT EARTHWORKS - USE CODE 640HOPEWELL ELEMENTARY SCHOOL - USE CODE 650STREAM CORRIDOR PROTECTION ZONE 14.2 ACRESEXISTINGHOUSES - R1EXISTINGHOUSES - R190’599’272’EXISTINGHOUSES - R1EXISTINGHOUSES - R1EXISTINGHOUSES - R1337’179’SWALE546’SWALE261’651’EXISTINGSTRUCTURE1333333444LEGEND ':+56+0) #52*#.6 &4+8'9#;  #&,#%'06 *1/'5+6' Ä 4  ':+56+0) 64''.+0'  911&'& #4'#  12'0 )4#55 /'#&19  (.11&2.#+0 61 $' 2416'%6'&12345EXISTINGHOUSES - R1INVENTORIED TREES 111678905/15/240 25 50 100 200NBRIGHT ROADBRBBBBBBBBBBBBRIGBRIGBRIGBRIGBRIGBRIGBRIGBRIGBRIGBRIGBRIGBRIGBRIGBRIGHHHTHTHT HT RHT RHT RHT RHT RHT ROOOAD1111114338 Bright Road : Existing Conditions (Images)12233445578910610 05/15/240 25 50 100 200N4338 Bright Road : Existing Conditions (Tree Survey)EXISTINGTREES TO REMAINEXISTINGTREES TO REMAINEXISTINGTREES TO REMAINEXISTING TREES ALONG ROADWAY TO REMAINEXISTING TREES ALONG ROADWAY TO REMAINEXISTING TREES ALONG PROPERTY LINE TO REMAIN 05/15/240 25 50 100 200NBright RoadPRELIMINARY UTILITY EXHIBITPRELIMINARY UTILITY EXHIBIT4338 Bright RoadGRAPHIC SCALE01 inch = 60 feet12030 604338 Bright Road : Existing Conditions (Preliminary Utilities) 2222222222255444405/15/240 25 50 100 200N4338 Bright Road : Framework PlanSINGLE POINT OF ACCESSHOLDER-WRIGHT EARTHWORKS - USE CODE 640HOPEWELL ELEMENTARY SCHOOL - USE CODE 650GREEN SPACE PRESERVEDCONNECTION TO PARK TO THE SOUTH HANNA HILLS DRIVEHANNA HILLS DRIVELEGEND 12'0 52#%' 4'5'48'&    5614/9#6'4 &'6'06+10 #4'#  &'8'.12/'06 <10'  .#0&5%#2' $7(('4  +06'40#. 564''6 #0& 5+&'9#.- %1746  5614/9#6'4 &'6'06+1012345EXISTINGHOUSES - R113333333 05/15/240 25 50 100 200N4338 Bright Road : Concept Plan40’ ROW40’ ROW50’ ROW40’ ROW100’90’90’90’90’90’100’140’100’100’90’120’120’145’103’105’ 70’110’60’40’80’80’130’30’ EASEMENT30’ EASEMENT30’ LANDSCAPE BUFFER30’ LANDSCAPE BUFFER85’30’ EASEMENT140’30’80’30’ LANDSCAPE BUFFERBRIGHT ROADGRANDEE CLIFFS DRIVEHOLDER-WRIGHTEARTHWORKSHOPEWELL ELEMENTARY SCHOOL130’116’SITE DATA616#. 5+6' #%  12'0 52#%'  9'56 911&5 #%  $+..+0)5.'; 470    #% %'064#. %1746     #%  .#0&5%#2'$7(('45   #%  &'6'06+10 $#5+0    #%   108’OPENSPACE CENTRAL COURTOPEN SPACE WEST WOOD W/ STORMWATER DETENTIONOPEN SPACE BILLINGSLEY RUN110’115’ DISCHARGEPOINTDISCHARGEPOINT05/15/240 25 50 100 200N4338 Bright Road : Concept Plan (Stormwater Drainage System)BRIGHT ROADBRIGHT ROADGRANDEE CLIFFS DRIVEHOLDER-WRIGHTEARTHWORKSHOPEWELL ELEMENTARY SCHOOLSTORAGESTORAGE6൹%6൹5)൵&൶6725൵*൶ 05/15/240 25 50 100 200N4338 Bright Road : Concept Plan (Water Utilities)BRIGHT ROADBRIGHT ROADGRANDEE CLIFFS DRIVEHOLDER-WRIGHTEARTHWORKSHOPEWELL ELEMENTARY SCHOOLCONNECTIONTO MAINCONNECTIONTO MAINHOUSESERVICE (TYP)HYDRANT 05/15/240 25 50 100 200N4338 Bright Road : Concept Plan (Sanitary Utilities)BRIGHT ROADBRIGHT ROADGRANDEE CLIFFS DRIVEHOLDER-WRIGHTEARTHWORKSHOPEWELL ELEMENTARY SCHOOLCONNECTIONTO MAINCONNECTIONTO MAINHOUSESERVICE (TYP)MAIN LINE EXTENSION BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTSTREETSCAPE & SITE PLAN BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTEXTERIOR INSPIRATION THE ARCHITECTURAL AND STYLISTIC GOALS OF THE NEIGHBORHOOD ARE DERIVED FROM SOME OF OUR FAVORITE TOWNS IN THE REGION. WE HOPE TO CAPITALIZE ON THE DOMESTIC SCALE OF THIS NEIGHBORHOOD THAT HAS JUST A COUPLE DOZEN HOMES. WE THINK THE COMMUNITY CAN RETAIN A DELIGHTFUL SCALE WITH A MASSING STRATEGY THAT RETAINS ONE AND ONE-AND-A HALF STORY BUILDING ELEMENTS THAT UTILIZE CONSISTENT DETAILING OF ROOF PITCHES, WINDOW FENESTRATION, EAVE DETAILS, COLORS AND ENTRANCE PIECES. USING A LIMITED PALETTE OF MATERIALS, YET COMBINING THEM IN CREATIVE WAYS MIGHT PROVIDE THE BASIS FOR MIMICKING THE VILLAGES AND ENCLAVES OF AN EARLIER PERIOD WHERE THERE SIMPLY WEREN’T AS MANY VARIED CHOICES.THE REFERENCE IMAGES WE HAVE BEGUN TO COLLECT COME FROM SOME OF OUR OWN PROJECTS BUT ALSO ARE DRAWN FROM OTHER SOURCES. THESE ARE BY NO MEANS CONCLUSIVE, BUT RATHER BEGIN TO ESTABLISH A VOCABULARY FOR THE STYLISTIC DIRECTIONS WE MIGHT IMAGINE THE HOMES TAKING. BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTEXTERIOR INSPIRATION BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTEXTERIOR INSPIRATION THE GENERAL STRATEGY FOR OUR DESIGN DIRECTION IS FOUND IN LOCAL RESIDENTIAL NEIGHBORHOODS FOUND IN OUR REGION A CENTURY AGO. FROM SUBURBAN EXAMPLES IN DUBLIN, TO UPPER ARLINGTON, BEXLEY, AND POCKETS OF THE CITY...WE SEE FORMS AND MASSING STRATEGIES THAT HAVE A FOCUS AND CLARITY OF ‘PARTS’. WE THINK FOCUSING STRONG ATTENTION ON THE DELICATE SCALE OF SOME OF THESE HISTORIC ANTECEDENTS COULD BE INFORMING AS WE ATTEMPT OR CREATE A NEW NEIGHBORHOOD WITH STYLISTIC CLARITY WHILE DEVELOPING CONTINUITY BUT AVOIDING MONOTONY. WHILE THE IDENTIFIED PROGRAM FOR THE NEIGHBORHOOD WILL BEGIN WITH A SIMPLE TYPOLOGY OF A FEW PLAN TYPES, IT IS ACKNOWLEDGED THERE IS AN OPPORTUNITY TO VARY THE TYPES WITH GARAGE CONDITIONS, HOUSE ORIENTATION AND MATERIALITY. WE ENVISION A VARIETY OF MATERIALS, BUT WE ALSO IMAGINE SOME VERY CONSISTENT ROOF PITCHES AND EAVE CONDITIONS. THE HOMES WILL BE DESIGNED TO BE ‘4-SIDED ARCHITECTURE’ AND WILL AVOID BLANK FACADES ON ANY ELEVATION. BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTEXTERIOR INSPIRATION AS REFERENCED IN SOME OF THE IMAGES WE ENVISION A MIX OF STONE, STUCCO, BRICK, AND SIDING(CEMENTIIOUS) USED IN TRADITIONAL METHODS. WE ENVISION A LIMITED PALETTE TENDING TOWARD LIGHT VALUES FOR THE WALL PLANES AND DARKER VALUES FOR WINDOWS, DOORS, AND ACCENT PIECES. ROOF- THE ROOFS WILL BE A 40-YEAR ARCHITECTURAL GRADE ASPHALT SHINGLE OF A CONSISTENT SPECIFICATION TO MIMIC A TRADITIONAL SLATE ROOF. WALLS- THE WALLS WILL BE THINSET BRICK OR STONE WITH A COLORED MORTAR, OR PAINTED BRICK OR CEMENT BOARD. GUTTERS/DOWNSPOUTS- WE ARE PLANNING ON UTILIZING 1/2 ROUND GUTTERS AND DOWNSPOUTS TO REINFORCE THE HISTORIC INSPIRATIONS IN THE DETAILS. SHUTTERS- WHEN USED, SHUTTERS WILL BE SPECIFIED TO COVER THE OPENINGS IN WHICH THEY FLANK. DECORATIVE HARDWARE SHOULD BE IMPLEMENTED TO HINT AT THE IDEA THEY COULD BE OPERABLE BUT IT IS NOT REQUIRED THEY OPERATE. EXTERIOR LIGHTING- IT IS OUR INTENT TO SPECIFY JUST A FEW FIXTURES THAT WILL SUPPORT THE ARCHITECTURAL STYLE. THERE WILL BE AN ATTEMPT TO MANAGE THE USE OF ‘ECCENTRIC EXPRESSIONS’ IN THE LIGHTING STRATEGIES FOR THE PRIVATE RESIDENCES. SITE FEATURES WILL ALSO UTILIZE FIXTURES CONSISTENT WITH THE RESIDENCES. BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTEXTERIOR INSPIRATION ONE OF THE GOALS OF THE NEIGHBORHOOD IS THE SENSITIVE GRADING STRATEGY AND THE ‘LOW IMPACT’ TO REWORKING THE EXISTING TOPOGRAPHY. SOME OF OUR REFERENCE IMAGES SHARE NOTIONS ABOUT STREET SIDE FENCES, WALLS, HEDGES, AND WALLS. WE IMAGINE THIS EDGE-CONDITION TO THE PRIMARY STREET WILL BECOME A SPECIFICATION THAT MIGHT VARY FROM HOME TO HOME, BUT WOULD BE A CONTINUOUS THREAD THAT KNITS THE HOMES TOGETHER. BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTEXTERIOR INSPIRATION BRIGHT ROAD NEIGHBORHOOD10 MAY 2024JONESROUGH DRAFTEXTERIOR INSPIRATION THIS BOOK HAS BEEN AN INSPIRATION TO THE OWNERSHIP TEAM AND PROVIDES US AS ARCHITECTS WITH SOME OVER-ARCHING GOALS FOR SETTING AND DEVELOPMENT OF THIS SMALL-SCALE NEIGHBORHOOD. IT IS A VALUABLE REFERENCE FOR STRATEGIES OF PLANNING AND DESIGN, AS WELL AS THE ACTIVATION OF THE PUBLIC SPACES AND LINKAGES TO A LARGER CONTEXT. WE IMAGINE THE STYLISTIC EXPRESSION OF THE RESIDENT VOCABULARY MAKING IT’S WAY INTO ALL OF THE SITE INFRASTRUCTURE IN THE FORM OF PIERS, LIGHTS, PAVILIONS, PATHS, MAILBOXES, SIGNAGE AND THE LIKE. Page 36 of 40 16. Concept Review Plans (for reference) The following information is a summary from the Concept Review phase of this project’s process, dated 5/15/24 and Planning & Zoning Commission Hearing dated 6/20/24. In addition to the narrative, plans and other supporting graphics submitted above for review, we are herein summarizing portions, in direct quotation and/or paraphrased summary of the Meeting Minutes prepared by Staff, of Commission comments, Public comments, Commission questions and discussions among Commission Members and with the Applicant. Additionally, Applicant is providing brief “responses” to each of these items, where appropriate, demonstrating understanding and consideration of all through written descriptions supported by the narratives, standards and descriptions submitted as a part of this Preliminary Development Plan and Preliminary Plat. This summary information is provided as a convenience to the Staff, Commission and the public as they consider the merits of this proposed development. Staff Presentation x Project site is currently located within the Suburban Rural Residential Land Use designation, according to the current Community Plan. o Agreed x Project site is within the Residential, Low Density Future Land Use designation within the Envision Dublin Community Plan that is now in the adoption process. o Agreed x Proposal will require rezoning to a Planned Unit Development (PUD) that includes 20 single- family lots on the 14 acre site, 1.4 du/ac. o Agreed x There is a focal point with Lot #7 that may need to be addressed o Current layout has modified lot layout in this area in response to Commission and neighborhood comments. However, the “focal point” of the Main Drive alignment is to be addressed by a landscape feature in keeping with the development character to terminate the view. x The development is eligible for the Conservation Design Resolution. o Agreed and is being pursued x The development will also need to follow the Neighborhood Design Guidelines o Agreed and is being pursued x The stormwater detention would result in the removal of some of the tree canopy o Agreed, yet the detention area in the West Wood is being carefully and strategically located, configured and graded to impact as FEW “Good” trees as possible with the majority of trees being impacted/removed are of “Fair” or “Poor” quality. Commission Questions Mr. Way Requesting additional description of the stormwater detention proposed in the West Wood area. Inquired if the area would include intentional stormwater retention areas. x This area will provide both stormwater management and public open space. The detention area will not only satisfy the management needs of the entire development but will also over-compensate for storage from the free-draining neighborhood to the north, which currently passes thru the development site. This storage area will be in a “dry basin” with a controlled release devise discharging into the currently utilized Page 37 of 40 outflow swale running west to the river. The basin is to be configured, graded and landscaped to be an integral part of this West Wood area, being developed at a publicly-used park, complete with amenities for users. See attached development plans for a graphic depiction of this space. Center Court to incorporate a roundabout drive or if it could have a road on only one side. It could be improved by having less concrete or asphalt. Intention of Center Court for stormwater detention. x The Central Court continues to have a publicly-dedicated drive on all sides. This condition, along with the internal roadway/walkway system, provides for pedestrian and bicycle user access to the functional community green space it provides. However, it is desired that the west leg of this court roadway system be as modest in width (servicing only TWO homesites) as is practical for vehicle/safety vehicle usage. The current proposal suggests a flush curb on the inside of this loop, paver parking “pads” for visitor parking on this side (without having to increase road width unnecessarily), encouraging direct pedestrian access to the open space but providing for proper radius dimensions of fire vehicle function. Agreed on the latter point of less pavement! Always the goal! Furthermore, the Central Court is no longer to be used for stormwater management, but strictly as public community open space. x Perimeter trees in the West Wood (in Fair and Good condition) are intended as a landscape buffer and will be protected at the drip line of those trees. o Yes! The level of tree removal and the basin layout/grading will be dictated by storage demands as required by Engineering. And the quality of trees to be considered in that effort, part of Final Engineering of the storm system. No more trees than are necessary for this system are proposed for removal and all remaining trees will be properly protected per sound arboriculture practices. Ms. Harter If the detention area is to be usable greenspace, would the grasses be coarse and less friendly play area? x Current thinking for the basin is that it would have a planted bottom/sides for erosion protection. Further, there may be other plantings incorporated to help naturalize the area (ie: trees/shrubs that don’t adversely effect storage volumes), diversify the plant community and add to the aesthetics of the entire area. It is not anticipated that this area be manicured lawn requiring regular mowing due to its water storage function which may leave the bottom wet for some period of time after a rain event. But, this area will certainly be available to wildlife, pet usage, and general “passive” park functions, aesthetics and amenities. Sidewalk on one side of the interior street be wider than a typical walk? x Presently, the sidewalk is proposed as 4’ wide and built of specialty pavement (brick, precast concrete) to better blend with the intent and character of the development (intimate streetscapes, homes closer to the street, rich materials, “hamlet” character vs “subdivision”). This provides for more green areas in the streetscapes vs pavement that is unnecessary. Given the modest scope of the development (only 20 homesites), a single sidewalk will provide pedestrian access from/to every lot and destination, especially given the extremely low traffic volumes in and around the development making casual street crossing very easy. This system of roads/walks is not interconnected to other surrounding developments (surrounded by built-out neighborhoods), thereby eliminating any off-site traffic. If additional width and/or walks are to be required, pavement materials will likely revert to cast-in-place concrete, due to project budget. Page 38 of 40 Will garages be 3-car and side-loaded? x Attached or detached garages will be 2, 2.5 and 3-car in size are intended to be side loaded as the preferred orientation and/or will be oriented to minimize garage door exposure to/from adjacent streets. Lot layout of this development is unconventional due to natural areas being preserved, drainage/floodway, existing trees and site topography dictating that house/garage layout, placement, orientation will be customized and sensitive to all of those conditions on a per-lot basis. Additionally, some homesites may contain auxiliary, additional-car free-standing garages as well. Development Standards to dictate placements and orientation. Homes to have individualized landscape, a type of green architecture? x Yes. The public realm of this development os paramount to its character. The streetscape, home placement, front yard/entry zone are all to work in concert to create the intimate village feel. Development Standards speak to the front entry zone, yard landscape, lighting, semi-private enclosure (low hedge, wall, fence). Each house to have landscape design reflective/supportive of the architecture and vice versa. Mr Alexander Some traditional rear-yard recreation space is being sacrificed to have more frontage x No. The front setback is proposed to be 15’ and R/W throughout most of the development to be 40’ for sake of 1. Intimacy of streetscape (see above) and 2. Provide for more rear yard for recreation/social life, gardens, drainage, screening if desired. Typical Lot diagrams herein illustrate the special qualities of those areas. Mr Chinnock A bikepath is indicated in the Billingsley Run area. x No. At Concept Review stage, a soft-surface trail was considered through this area. But, given the environmental sensitivity of this area, its flood prone conditions and desire to preserve every tree in this street corridor and along the north side of Bright Road, even this soft-surface trail is being eliminated and the entire area is to be left in its current condition. Agreed, no need to provide connection from soft-surface trial. Similar trail indicated in the West Wood. x Agreed that soft-surface trail on the east side of the development is no longer proposed. The trail in the West Wood, an intentional passive park space by this proposal, will have that trail lead to Bright Road for direct access to the Wright- Holder Park on the south side of Bright Road. It is important to note that Bright Road is NO LONGER connected to Riverside Drive, there are only SEVEN single family homes west of Grandee Cliffs Drive that utilize Bright Road for access to their homes and a 25 MPH post speed resulting in a very low traffic volume which allows for ease of safe crossing access to the Wright-Holder Park. Mr Deschler Central Court to be a mowed areas or include some stormwater management? Page 39 of 40 x The current proposal eliminates stormwater management from this area and reserves it as more manicured and usable public open space. Possible for Central Court to be manicured space? x Yes! See above. It is preferable to avoid need for homeowner variances later to add rear yard structures. x Agreed. Development Standards accommodate such structures and the Typical Lot diagrams included herein demonstrate this private space layout. Why 20 homesites vs 14? x This proposal preserves naturalized open spaces as is possible, trees on edges, accommodates/manages on and off-site drainage and embeds public-use space within the development. Further, homesites proposed are “estate” size, meeting the market demand for this housing type. 20 homesites “fit” comfortably into this development zone and project economics require this number of lots. Ms Call How will you treat Lot #7 at the terminus of street entry? x Current layout has modified lot layout in this area in response to Commission and neighborhood comments. However, the “focal point” of the Main Drive alignment is to be addressed by a landscape feature in keeping with the development character to terminate the view. Public Comment John Rahm Biggest concern are the 7 homesites along the north boundary “in a straight line”. Consider larger lots there providing more greenspace. x Agreed. Current plan has removed one lot along this line, increased depth of those lots remaining and have reconfigured the street alignment and lot lines to eliminate the straight line geometry of the Concept Plan. Further, the Applicant has met with Mr Rahm and other on his neighbors to address this and other issue and have gained their support. Randy Roth Thanked the Applicant for meeting with the East Dublin Civic Association in May, 2024 and several times with association officers. One concern was landscaping along the development’s north property line. Very happy with proposed landscape and existing fence repair along Bright Road. Turning undevelopable areas into an amenity for residents and neighbors is generous. He has seen much enthusiasm for this project. x Agreed. Current plan has addressed the concerns of Mr Roth and the association. See above response. Applicant appreciates the attention paid and great comments given by the association and neighbors. The over-riding goal of this development is to fit into and elevate the neighborhood that it is to be a part of. Page 40 of 40 Commission Discussion Mr Chinnock Very nice use of site. Appreciates Applicant meeting with neighbors, very good job in creating a plan that will fit the site, greenspace is great. Inspirational architecture is beautiful, wants to make sure it blends with surrounding area. Understands the economics that drive the ned for 20 lots, applicant’s vision makes sense of the space. Mr Deschler Supportive of the proposed use and building materials. Believes Central Court open space should not be used for stormwater detention purposes. Recommends to alleviate straight row of houses along north perimeter. Perhaps some homes can have walk-out level, some variation to the look. Mr Alexander Very supportive, even enthusiastic about the plan. Less concerned about architecture matching the surrounding neighborhood, which were built at a different time. Creating community is more valuable. Central Court to be more about usable public space. Mr Way Very exciting proposal, great example of city’s Conservation Design Guidelines implemented, responsive to sensitive nature of the site. Encouraged preservation of trees and sufficient setback on north edge of the site. Hopeful that Applicant and neighbors can work out something to meet that intent. Applicant should look at facing homes to Bright Road, not disengaging from it, creating an urban design feel to the development could be spectacular. Ms Harter Supportive of the proposal, appreciates Applicant meeting with the association, encourage to keep the green tree look along Bright Road, even the brown fence. Appreciates Applicants efforts to use landscape and architecture to create outdoor living space. Ms Call Look for lot deletion on center section and along “back section” (north boundary?). This is a beautiful project- not what we see everyday. Page 1 of 40 Bright Road Reserve PRELIMINARY DEVELOPMENT PLAN CITY OF DUBLIN, OHIO January 17, 2025 Landowner: Developer: DNS Trust, Sally S. Haimbaugh, Trustee 9449 Cape Wrath Drive Dublin, Ohio 43017 Phone: 614.499.4466 Contact: Sally S Haimbaugh 4338 Bright Road Partners, LLC 8824 Dunsinane Drive Dublin, Ohio 43017 Phone: 614.286.5753 Contact: William H. Adams, Managing Partner Legal: Engineering: Plank Law Firm, LPA 411 East Town Street Columbus Ohio 43215 Phone: 614.221.4255 Contact: Don Plank Advanced Civil Design 781 Science Blvd, Suite 100 Gahanna, Ohio 43230 Phone: 614.793.8777 Contact: Thomas M. Warner Land Planning/Landscape Architecture: Architecture: MKSK 462 South Ludlow Alley Columbus, Ohio 43215 Phone: 614.621.2796 Contact: Brian P. Kinzelman The Jones Studio 503 City Park Avenue Columbus, Ohio 43215 Phone: 614.358.3729 Contact: Brian Kent Jones Page 2 of 40 CONTENTS Page Section A: Project Narrative ……………………………………………………………………………………… 4 Section B: Site Description 1. Property Location and Size ....................................................................................... 7 2. Character & Surrounding Uses .................................................................................. 7 3. Land Uses ............................................................................................................... 7 4. Open Space & Natural Features ................................................................................ 8 5. Provision of Utilities ................................................................................................. 8 6. Access and Circulation ............................................................................................ 9 7. Architecture ............................................................................................................ 9 Section C: Development Standards 1. Permitted Uses ...................................................................................................... 10 2. Density .................................................................................................................. 10 3. Lot Standards ........................................................................................................ 10 4. Streets, Access and Connectivity ............................................................................ 13 5. Utilities ................................................................................................................. 14 6. Open Space ........................................................................................................... 15 7. Tree Preservation, Removal and Replacement ......................................................... 16 8. Architecture .......................................................................................................... 17 9. Landscape ............................................................................................................ 19 10. Homeowners’ Association ...................................................................................... 20 11. Ownership & Maintenance ..................................................................................... 20 Page 3 of 40 Section D: Exhibits 1. Title Sheet/Vicinity Map/Regional Context Map ........................................................ 21 2. Existing Conditions Plan ......................................................................................... 22 3. Preliminary Plat/Development Plan ........................................................................ .23 4. Utility Plan .................................................................................................. …. …….24 5. Grading and Drainage Plan……………………………………………………….……………………....25 6. Vehicle Tracking Exhibit…………………………………………………………………………………….26 7. Open Space Framework & Connectivity Plan ............................................................. 27 8. Tree Survey .............................................................................................................. 28 9. Tree Data ................................................................................................................ 29 10. Landscape Plan ....................................................................................................... 30 11. Illustrative Plan ........................................................................................................ 31 12. Typical Lot Plans ..................................................................................................... 32 13. Street Section/Elevation ........................................................................................... 33 14. Lot Layout Diagrams/Character Images……………………………………………………………….34 15. Open Space Enlargement ......................................................................................... 35 16. Concept Review Plans (for reference) ........................................................................ 36 Page 4 of 40 SECTION A: PROJECT NARRATIVE The City of Dublin has become one of the finest communities in the country in which to live, work and socialize. Central Ohio as a whole is experiencing a significant demand for all levels of housing and Dublin is not immune to these needs. This development, though modest in size, looks to satisfy the desire of many to join in to the Dublin community and, those that have been here for years, to remain here as a vital part of the community that they helped to build. This development will be a unique and distinct offering within the City of Dublin with the combination of a high-quality site and custom architecture to enhance that position. The quiet nature of this segment of Bright Road (west of the Hopewell Elementary School) and its disconnection from Riverside Drive for vehicular traffic makes this site well suited for a hamlet/enclave of architecturally-controlled residences, not a conventional subdivision. It must and will provide for all of the safety, security and mobility needs of the community but should not be evaluated the same as much larger developments in very different settings. Its modest size and limited development site ensures a small number of homesites with a small population. This development is surrounded by established neighborhoods with no through connections to those adjacent neighborhoods by motor vehicle, bicycle or on foot. As such, wide streets are unnecessary since no through-traffic exists. Dual wide sidewalks and multi-use trails are unnecessary since no through connections for bicycles or pedestrians exist outside of the main street connection to Bright Road. This “dead end” infill site makes it the perfect opportunity for the quiet, intimate character community that is envisioned. It is to be a planned development, designed to fit the site it is to occupy. This community will likely cater to the empty-nester buyer at one end of the age continuum and the dual professional income young family at the other, each looking for the conveniences and amenities of Dublin, including adjacent Bridge Park restaurants and schools/parks respectively, among many others. This proposed development looks to embrace the Dublin reputation as a premier community and build upon the foundational elements of the Community Plan through addressing many specific elements of the “Dublin Character” applicable to this neighborhood. • Natural Features - Preservation and celebration for resident enjoyment the stream corridor on the east and woodlot to the west. • Rural Landscape – Respect and preserve the character of Bright Road and the overall landscape. • Historic Dublin – Connection to the Scioto River (the single most important natural element that facilitated the original settlement of Dublin) and the Historic Downtown, just a short walk away. • Cultural Heritage - Connect to/celebrate the Holder-Wright Earthworks Park, the Leatherlips sculpture/Scioto Park, the other parks and riverfront offerings. • Roadway Character and Streetscapes – Provide for intimate-scaled interior streetscapes with front-facing homes along the line streets segments, minimal R/W width allowing for more intimate corridor dimensions, less pavements, less walkways while insuring connectivity of all, robust street trees and manicured entry spaces, intentionally deviated from conventional subdivision character/scale and showcasing high-quality architectural style and landscapes. “More green, less gray.” • Parks, Reserves, Open Space – Preserved stream corridor and woods, public spaces, wooded perimeter buffers, residential courts, private landscapes. • Environmental Stewardship and Sensitivity – Minimize land disturbance through Conservation Design, naturally manage stormwater, revegetate the site with indigenous plantings. Page 5 of 40 • Quality of Life – Provide unique homes, fine living space, spectacular outdoor environments and help satisfy community housing needs. • High quality residential development – Fine quality materials, stunning architecture, tailored outdoor private spaces/amenities. Neighborhood Design - This development will respect the Conservation Design Ordinance and the Neighborhood Design Guidelines of the city. Much of this site has been used in the past for agricultural and “rural residential” purposes and, as a result, a significant portion has been previously cleared and was recently occupied by a single dwelling, since demolished. This development assumes that the previously cleared land would be used for housing in a way that minimizes disturbance and construction activity. Homesites are to be clustered in such a way that the existing stream corridor (Billingsley Run and tributary) is preserved/enhanced and its surrounding woods preserved. Streets are considered more as “mews” and less as “subdivision roads” with attention to details. The streetscape is intended to have an intimate feeling with indigenous street trees, possibly masonry piers for space definition, coordinated signage and other specialty details as approved by the City of Dublin Engineer. Open space connections are to be identified/accentuated by more detailed and intentional landscape at the entry points from the public domain. The Central Court on the west and the East Court on the east will provide for homesite driveway entries as well as meaningful public open space. The Central Court will include a flush edge and low up-lighted masonry piers, and tree plantings. Well-tailored landscapes for the “civic” side of home fronts will include entry zones, drives, walks and gardens in contrast to the naturalized “native” green areas of stream corridor, West Wood, buffers and drainageways. This community looks to be welcoming and inclusive with connection to the surrounding community at the Bright Road entry. Specialty paved sidewalks are to be considered and walks to be provided on one side of each street providing for pedestrian connection to/from every homesite, public space and postal facility Open Space Framework - Two major public open spaces are proposed, including the Billingsley Run and West Wood areas. The Billingsley creek bed itself and all existing woods surrounding it are to remain in protected Reserve form. The West Wood will provide for stormwater management, being at the lower end of the watershed of the site and is defined by preserved trees along its entire perimeter. This area will be enhanced by plantings to create outdoor space for the enjoyment of residents and neighbors alike. The stormwater storage is to be accommodated in a sensitively graded “dry basin” with well selected groundcovers that allow for the usage of this basin in dry conditions. Public Realm - All homes are to address their frontage street/court with prominence. Driveway access to garages is not to dominate the character of this statement but will provide that access way for residents and visitors to enter the homesites in an intentional way with proper detailing of this more public portion of the drive and provide for an attractive and meaningful walkway connection to the home entry. Driveways and entry walkways may be constructed partially or wholly of concrete, brick or stone, dependent upon the individual home design and materials palette. Each home is custom leading to possible variation of materials home to home. Each homesite will have a well detailed front yard that may include an entry garden that defines the semi-private space of the yard through foundation plantings, hedges, walls/piers, fencing segments and other devices to add to the character of the home, all in keeping with the materials/detailing of that home. Locations of possible front yard Improvements to be as described in Section C: Development Standards. Character images are included herein to aid in communicating design intent of these custom and uniquely designed homes and landscapes. Certain “outside corner” lots of irregular geometry may have homes sited further setback from the frontage street to take better advantage of lot dimensions, adjacent natural/green areas, increased privacy of outdoor spaces. Lots on the “perimeter” of the site, adjacent to existing neighborhoods are to have a protected landscape easement to preserve existing trees, allow Page 6 of 40 sufficient space to augment that area with additional planting and restricts homeowners from adversely affecting this buffer, all for sake of the privacy of residents on BOTH sides of the property line. The protection of these easements is to be managed and enforced by the HOA. Private Realm - Rear yards and appropriate portions of certain side yards are meant to be an extension of the interior “living space” of the homes. It is envisioned that each home will have well-articulated outdoor terrace/dining space, gathering areas with possible pool and/or spa, architecturally correct overhead structures such as trellises or pergolas. Manicured lawns and gardens (formal, cutting, vegetable, herb) are also anticipated, as may be desired by the individual homeowners. Certain “perimeter” lots will take advantage of the topography of the site and the natural features in visually “blending” these yard spaces into this existing environment without the conventional “backyard” feel. Auxiliary structures may also be considered, all within keeping of setbacks and architectural character of the home, for cabana/pool house, dining gazebo, secondary garage, depending on the desires of the individual homeowner. Page 7 of 40 SECTION B: SITE DESCRIPTION 1. Property Location and Size • The site is located completely within the City of Dublin and Franklin County, Ohio. • 14.17 acre site consisting of two contiguous parcels, Franklin County Tax Parcel #273-008618 containing 10.606 ac & #273-011149 containing 3.568 ac. located at 4338 Bright Road with existing access drive for previous single family dwelling (since demolished) at the intersection of Grandee Cliffs Drive. The property is the only remaining privately held developable parcel on the north side of Bright Road in this area. • The property is surrounded on all sides by existing single-family residential development with the exception of its western flag portion being directly north of the Holder-Wright Earthworks Park. • The combined Bright Road frontage dimension is 689.33 LF. No access or improvements proposed by this project includes the S-curve portion of Bright Road. 2. Character & Surrounding Uses • The site is bound on the east by the Billingsley Run and the wooded area to the east of that watercourse. The west is bound by a volunteer-growth woods that contains the drainage swale that drains the major western ¾ of the site. • The majority of the site and that area proposed for development was most recently occupied by a single residence and a swimming pool, both since demolished. A small garage structure is presently the only structure that exists on-site, is in poor condition and is to be demolished as a part of this development proposal. The supporting driveway to the former residence is also in poor condition and is to be demolished as well. The cleared site is thought to have been previously cultivated but in its more recent past was mown lawn and served as the yard space for the residence. This cleared area is to be used for homesite and roadway development. • The topography of the site is slightly rolling and gently falls to its east and west edges. The site layout reflects this form of the land. The roadway system is proposed to lay largely “at grade” with very little earthwork needed. The homesites are not anticipated requiring over-lot grading (ie: clearing/grubbing, earthmoving, etc.) but will be developed/graded individually to insure optimum placement in all dimensions and proper drainage of the sites. What trees that exist in this cleared area and that are in established “good” condition will be considered in building placement, orientation and grading in an effort to preserve them as possible. • The property is located south and outside of the Bright Road Area Plan and is surrounded by existing single-family housing (with the exception of the park referenced above) that was generally built in the 1970’s and forward. 3. Land Uses • Currently this project site is zoned R-1 Restricted Suburban Residential District and the proposed rezoning is to Planned Development. This site is presently vacant. Surrounding areas are residential uses, R-1 zoning with the exception of the public park south of Bright Road at the SW corner of this development site. • The Dublin Community Plan - Existing Land Use Map designates the site as “undeveloped”. • The Dublin Community Plan – Future Land Use Map designates the site as “Residential Low Density (0.5-1 dwelling unit per acre) • Proposed use is single-family residential. Page 8 of 40 • The proposed development embraces the tenets of “conservation design”, clustered home sites with “Reserve” areas for open space, tree preservation, habitat conservation, reforestation and localized storm water management. 4. Open Space & Natural Features • The West Wood, consisting largely of volunteer tree growth, will further provide for community open space and accommodate the stormwater management necessary for the development. This reserve, as defined by perimeter boundaries and proposed lot lines, consists of 2.40 acres and occupies the western portion of the site. • Billingsley Run, its tributary, floodway and surrounding woods are to be reserved as public open space and in its current condition. This reserve, as defined by perimeter boundaries and proposed lot lines, consists of 3.11 acres and occupies the eastern portion of the site. • Generous and dense perimeter buffer areas, mostly on the north and south boundaries, are to be reserved and provide for visual separation from adjacent homesites. These perimeter preservation areas consist of various species of mature plants, to be augmented by new plantings as may be needed. These preservation areas are to be placed in perpetual landscape easements that allow for consistency in the landscaped edges and consists of 0.62 acres. 5. Provision of Utilities General • Both public Sanitary Sewer and Water systems exist adjacent to the site along Bright Road. These two systems will be utilized for service to the development. The capacity and condition have been determined while the exact locations are to be determined in the Engineering phase following the Preliminary Development Plan. • On-site stormwater management is to be provided meeting the City of Dublin Engineer requirements and design criteria. • All private utilities, including communications, internet/cable, electric, and gas are available to this site. Commitment correspondence to be provided at Final Development Plan. • All utilities are to be designed and constructed to meet the standards established by the City of Dublin Engineer. Sanitary Sewer • Sanitary sewer service to the development will be provided from one (1) location. • The proposed development will be serviced from an existing 8-inch line located adjacent in the Bright Road R/W south of the site. Water • An existing 8-inch water main along the south side of Bright Road is adequate to provide service to this site. Storm Water – Existing • The current site is divided into two watersheds, roughly along the ridge line of the existing driveway, with the major watershed draining to the west into an open swale leading to the Scioto River. Portions of the residential neighborhood to the north (Hanna Hills) drain to and through Page 9 of 40 the site to the open swale described above. The minor watershed drains east into Billingsley Run, its north tributary and on to the Scioto River as well. • This development lies within the Little East Watershed and the Billingsley Creek Watershed, requiring more stringent storage and release rates, as determined by the City of Dublin Engineer. • The predominately soil type is Blount Silt Loam, End Moraine (Ble1B1), a Type D soil, corresponding to the pre-developed run-off coefficient of 0.52. 6. Access and Circulation • Vehicular access to the site from the public R/W will be from a single access point on Bright Road at the intersection of Grandee Cliffs Drive. No public transit facilities exist to this site. • No multi-use trail or sidewalks from the public right-of-way currently exist to this site. 7. Architecture • One building exists on-site, a dilapidated garage in very poor condition and is proposed to be demolished by this development. • No prevailing architectural style is evident in the surrounding neighborhoods. A wide range of styles, masses, materials, colors and orientations is observed, leaving no precedent of character to be emulated. The quality of home architecture and site development is the standard to be reflected and even exceeded by this development. Page 10 of 40 SECTION C: DEVELOPMENT STANDARDS Development to be in accordance with the City of Dublin Code at the time of development unless otherwise noted. Where conflicts occur between the City of Dublin Code and these Development Standards, the Development Standards shall apply and supersede the Code. Unless otherwise specified in this Preliminary Development Plan drawings/text, the development standards of Chapter 152 and 153 of the City of Dublin Code, City of Dublin Neighborhood Design Guidelines and Conservation Design Development standards shall apply. 1. Permitted Uses Permitted uses shall include the following: • Single-family detached residences. • Publicly and/or privately-owned open spaces, stormwater facilities and related park features. • Home occupation uses in accordance with City of Dublin Code Section 153.073(B). 2. Density A maximum of 20 residential lots consisting of single-family residences on a gross site area of 14.17 acres and a resultant density of 1.4 dwelling units per acre. 3. Lot Standards Single-family homes in this development will be constructed on traditional lots with fee simple ownership. Each home proposed is to be custom designed and built in response to its lot. Existing site conditions and the desire to preserve as much of the natural environment as is practical have dictated the lots’ configurations. As such, each lot is somewhat unique in shape requiring detailed setback standards as stated below. Lot Size Lot Area: 9,960 square feet, minimum (smallest, Lot #19) 21,443 square feet (largest, Lot #10) 13,731 square feet (average) Lot Width: 29’ minimum width (R/W frontage), Lot #5 Lot Depth: 107’ minimum (side property line), Lot # 19 Maximum Lot Coverage: Not-to-exceed 45% Elements to be considered as lot coverage include primary structure, enclosed auxiliary structures, driveways, entry walks, paved terraces/patios. Open joint decks, dry-laid masonry terraces/patios, open trellises/pergolas are not considered in Lot Coverage. Side yard setback areas as described herein are to be clear of ground-mounted mechanical devices. Pedestrian pavements, landscape and HOA-approved fencing may be permitted. Page 11 of 40 Private Open Spaces to include lawns, terraces, decks, patios, fireplaces, open air garden structures, swimming pools/decks/barriers, ornamental fountains, gardens and seating areas. Lot Setbacks Lot #1 (Corner Lot) 15’-20’ Front Build-to-Zone 15’ Corner Side Build-to-Zone (east side) 40’ Minimum Rear Setback to Principal Structure 20’ Minimum Rear Setback/No-Build Zone to Private Open Space/Landscape Easement 6’ Minimum Side Yard (west side) 25’ Minimum Depth Private Open Space Lot #2 15’ Minimum Front Setback (no Build-to limit, inside corner lot) 40’ Minimum Rear Setback to Principal Structure 20’ Minimum Rear Setback/No-Build Zone to Private Open Space/Landscape Easement 6’ Minimum Side Yard (east side) 20’ Side Yard/Landscape Easement (west side) 25’ Minimum Depth Private Open Space Lot #3&4 15’-20’ Front Build-to-Zone 30’ Minimum Rear Setback to Principal Structure 15’ Minimum Rear Setback/No-Build Zone to Private Open Space 6’ Minimum Side Yard, 12’ Minimum Total both sided 25’ Minimum Depth Private Open Space Lot # 5 15’ Minimum Front Setback (no Build-to limit, inside corner lot) 40’ Minimum Rear Setback to Principal Structure 20’ Minimum Rear Setback/No-Build Zone to Private Open Space/Landscape Easement 6’ Minimum Side Yard (east side) 20’ Side Yard/Landscape Easement (west side) 25’ Minimum Depth Private Open Space Lot #6-9 15’-20’ Front Build-to-Zone 40’ Minimum Rear Setback to Principal Structure 20’ Minimum Rear Setback/No-Build Zone to Private Open Space/Landscape Easement 6’ Minimum Side Yard, 12’ Minimum Total both sided 25’ Minimum Depth Private Open Space Lot #10 15’ Minimum Front Setback (no Build-to limit, inside corner lot) 40’ Minimum Rear Setback to Principal Structure (north Rear) 20’ Minimum Rear Setback/No-Build Zone to Private Open Space/Landscape Easement (north Rear) 40’ Minimum Rear Setback to Principal Structure (east Rear) 15’ Minimum Rear Setback/No-Build Zone to Private Open Space (east Rear) Page 12 of 40 6’ Minimum Side Yard, 12’ Minimum Total both sided 25’ Minimum Depth Private Open Space Lot #11 15’ Minimum Front Setback (no Build-to limit, inside corner lot) 40’ Minimum Rear Setback to Principal Structure 15’ Minimum Rear Setback/No-Build Zone to Private Open Space 6’ Minimum Side Yard, 12’ Minimum Total both sided 25’ Minimum Depth Private Open Space Lot #12 (Corner Lot) 15’-20’ Front Build-to-Zone 15’-20’ Corner Side Build-to-Zone 40’ Minimum Rear Setback to Principal Structure 15’ Minimum Rear Setback/No-Build Zone to Private Open Space 6’ Minimum Side Yard (north side) 25’ Minimum Depth Private Open Space Lot #13 15’ Minimum Front Setback (no Build-to limit) 40’ Minimum Rear Setback to Principal Structure (west Rear) 15’ Minimum Rear Setback/No-Build Zone to Private Open Space (west Rear) 6’ Minimum Side Yard (north side) 20’ Minimum Side Yard Setback/No-Build Zone to Private Open Space/Landscape Easement (south side) 25’ Minimum Depth Private Open Space Lot #14,15,18,19 15’-20’ Front Build-to-Zone 40’ Minimum Rear Setback to Principal Structure 15’ Minimum Rear Setback/No-Build Zone to Private Open Space 6’ Minimum Side Yard, 12’ Minimum Total both sided 25’ Minimum Depth Private Open Space Lot #16 &17 (Corner Lots) 15’-20’ Front Build-to-Zone 15’-20’ Corner Side Build-to-Zone 40’ Minimum Rear Setback to Principal Structure 15’ Minimum Rear Setback/No-Build Zone to Private Open Space 6’ Minimum Side Yard, 12’ Minimum Total both sided 25’ Minimum Depth Private Open Space Lot #20 (Corner Lot) 15’-20’ Front Build-to-Zone 15’-20’ Corner Side Build-to-Zone 40’ Minimum Rear Setback to Principal Structure 15’ Minimum Rear Setback/No-Build Zone to Private Open Space 6’ Minimum Side Yard (north side) 20’ Minimum Side Yard Setback/No-Build Zone to Private Open Space/Landscape Easement (south side) 25’ Minimum Depth Private Open Space Page 13 of 40 4. Streets, Access and Connectivity • Single point of access from Bright Road at the current intersection of Grandee Cliffs Drive. Street name to be determined at Final Plat, identified as Street A on Preliminary Plat. This access to and through the site is proposed to be public R/W and meeting the requirements of the City of Dublin Engineer. • Curb radius at Street A entry, 30’ • The new road into and through the site is to be renamed as part of the Final Plat. • All lots are to access from internal street system with no direct lot vehicular access to Bright Road. • Public Streets Standards: a. Right-of-Way: 50’ (Street A from Bright Road to 1st intersection with Street B) 40’ (all other streets) b. Pavement Width: 26’ asphalt pavement (Bright Road to 1st intersection with Street B) 24’ asphalt pavement (all other streets) c. Drive Lanes: Two (2) d. Parking Lanes: Parking shall be allowed on one side of the public streets internal to the development. e. Tree Lawn: 5’ minimum width f. Sidewalk: Pedestrian circulation through the site is to be provided by a 5’ wide walk of cast-in-place concrete as the minimum level of quality with the possibly of brick pavement at the sole discretion of the Developer, on one side of the street providing access to all homesites, open spaces and destinations in the development. ADA-compliant driveways for homes that do not have a sidewalk (Lots 1-12) are to be provided to establish full connectivity. Walkway to be provided at the perimeter of the Central Court to provide access to the CBU mailboxes. Developer to provide painted crosswalks across Street A at Bright Road and across Bright Road west of Street A, including curb ramps and receiving concrete-paved corner walk pads at all three corners, per City of Dublin standard. Developer to provide painted crosswalk across Bright Road at west end of development connecting proposed maintenance path (described herein) to the south to the Holder-Wright Earthworks Park. All crosswalk construction is to be coordinated with the Dublin City Engineer relative to timing for installation with City- provided trail construction along Bright Road. g. Curbs: 6” concrete straight curb, flush curb on external edge of Central Court. Page 14 of 40 h. Trails: 8’ width specialty pavement path approximately 140’ in length is to be provided from Central Court to the east side of the detention basin, and possibly a casual seating area in the West Wood at the discretion of the Developer, providing pedestrian access to this area. This is not a shared use path, is not proposed to be developed to that city standard and is not intended for maintenance access to the detention facilities (to be provided elsewhere). Revegetation in this West Wood area as replacements for the cleared trees is to be provided per Landscape Plans, Section D: Exhibits, with no further amenities/improvements proposed. 5. Utilities a. Design and Construction: All utilities shall be designed and constructed to meet the standards established by the City of Dublin Engineer. b. Location: All utilities shall be placed in appropriate locations on the individual homesites that will best preserve the existing trees in good condition. See Utilities Plan, Section D: Exhibits • A comprehensive stormwater management system to be developed, following the City of Dublin stormwater management policies. See Grading & Drainage Plan, Section D. This development lies within the Little East Watershed and the Billingsley Creek Watershed, requiring more stringent storage and release rates, as determined by the City of Dublin Engineer. Given the proximity of the project site to the Scioto River and the convergence of the two on-site watersheds at the river, a single oversized basin and restricted outlet structure in the west of the site will accommodate all stormwater storage requirements of the project while the much smaller eastern watershed will direct drain into Billingsley Run. • The exact discharge point and release rate for the western portion of the site is as determined acceptable to the City of Dublin Engineer. The west watershed currently drains through a swale channel to the west and ultimately to the Scioto River. The smaller east watershed free drains into Billingsley Run and ultimately to the Scioto River as well. In the post-development condition, the site drainage will be handled by one (1) stormwater management system consisting of a dry basin with controlled outlet. The system will accept drainage from pervious areas such as rear yards, side yards, and the off-site 0.46 acres mentioned above, and impervious areas such as roadways, roofs, and sidewalks. • Developer to provide a 10’ wide paved path for the periodic maintenance of the outflow structure of the detention basin in the West Wood, currently designed to be at the southwest end of the basin. This path will be from Bright Road routed north approximately 400’ to the outflow structure vicinity as generally shown on Utility Plan and is to be field located to avoid any unnecessary damage to the existing vegetation. • Rear yard drainage system is to be provided to ensure positive drainage in these rear yard areas and conveyance to the proposed stormwater management system. Page 15 of 40 • Impervious surfaces will drain to catch basins in the roadway. The storage basin will have a forebay collection pool that is meant to filter out heavy debris before entering the discharge swale. • Portions of Lots #10, 11, 12, 13 will free drain into the adjacent Billingsley Run or its north tributary. • Billingsley Run and its north tributary are to be protected by a Stream Corridor Protection Zone (SCPZ) as calculated and scribed as shown herein in conformance with the practices provided by the City of Dublin Engineer. West swale has been exempted by the City of Dublin Engineer from SCPZ requirements. 6. Open Space Based on the location of the development and best practices, the proposed open space reserves are to be owned and maintained by the City of Dublin and/or the Homeowners’ Association as described herein. Final disposition relative to ownership and maintenance responsibilities to be determined through further conversations with the City of Dublin. Reserve A: Approximately 2.40 acres of open space, including the West Wood and the Allee (0.11 acre area included in the West Wood acreage), which connects this open space to the Central Court (Reserve C) is to be deeded to the City of Dublin with agreed-to restrictions on use. Given its location in the watershed and topography, this area is to contain the utilitarian function of a “dry” basin for stormwater management, yet is to be shaped, planted and protected as an open space Reserve. In light of its location relative to existing surrounding neighbors who abut this Reserve, it is the intent of this development proposal that Reserve A (as with Reserve B described below) is to remain passive in use and nature with no additional programming, hard-surface trails, park apparatus, etc. for the entire neighborhood’s continued quiet enjoyment of the greenspace. Within the City of Dublin, there is precedent for such passive public open space, namely Thaddeus Kosciuszko Park and Wellington Reserve. Long-term maintenance of the basin landscape described above to be by the City of Dublin. This area’s natural environment will be enhanced through thoughtful grading for stormwater management, reforestation with environmentally correct indigenous plants and a naturalized landscape. Revegetation in this West Wood area as replacements for the cleared trees is to be provided per Landscape Plans, Section D: Exhibits, with no further amenities/improvements proposed. Reserve B: Billingsley Run, approximately 3.11 acres, is to be deeded to the City of Dublin with agreed-to restrictions on use as public open space and for the city’s long-term maintenance. It is intended to be left in its current and natural state with no intentional intervention into it. Reserve C: The Central Court, 0.28 acres, is open space described and enclosed by the public street R/W in a prominent, intentional central location to the residents of the development for their non- exclusive use as a communal gathering area. Open lawn and edge tree plantings are intended to provide a sense of place while remaining visually open for natural surveillance and public safety Reserve D: The East Court Island, 0.027 acres, is open space for landscape purposes to eliminate areas of unnecessary pavement and provide visual enhancement. This open space is to be maintained by the HOA. Landscape Easements, predominantly on the north and south edges of the development are intended to preserve existing trees there through deed restrictions on development, provide space Page 16 of 40 for augmenting these existing tree stands with new plantings and allowing for the long-term protection of these greenspaces from encroachment or development. These open space areas are to contain a mixture of trees and shrubs to enhance the rural character of the area and will be a part of the Landscape Plan in the Final Development Plan. In summary, dedicated, HOA maintained and easement-protected open spaces total 6.38 acres of this 14.20 acre site (or 45%) and is to be maintained as open space post-development, the level of which is to be determined in conjunction with the City of Dublin and as currently described in 11. Ownership and Maintenance. No Entry Feature is anticipated as a part of this development in an effort to create a seamless physical and practical connection to the surrounding neighborhood. Existing Bright Road frontage is anticipated to remain in its current condition with exceptions for repairs and limited removal of the existing wood fencing and plant additions and/or pruning as described herein. Current entry gates and masonry piers are to be removed to accommodate new Street A construction. All of these Reserves and Landscape Easements are described and labeled on the Preliminary Development Plan. In combination, this open space is to be considered to fulfill Subdivision Regulation requirements for Open Space Requirements (152.086) and Land Dedication For Municipality’s Portion of Recreational Facilities (152.087). 7. Tree Preservation, Removal and Replacement a. Tree Preservation: It is the intent to preserve as many good condition trees as possible on the site. A good faith effort will be made to preserve these existing trees where appropriate. High quality trees required to be removed for sake of infrastructure are to be accounted for on the Tree Replacement Plan as a part of the Final Development Plan. b. Tree Preservation Zone: • Development is not anticipated in the wooded perimeter along Bright Road, the northern property line, the southwestern “flag” connecting to Bright Road (excepting maintenance path) and the entire area east of Billingsley Run. Existing trees there are to be preserved with the possible exception of trimming/removal based on individual plant condition and sound arboriculture practices. • Billingsley Run Reserve including Billingsley, its north tributary, the wooded area east of these watercourses and existing trees west of the watercourses within the Floodway or SCPZ are to be preserved, and these areas be left in their current undisturbed state with no further intervention or development. • The West Wood is to be utilized for the stormwater management of the development and is to be revegetated to include the introduction of plantings in ecologically correct varieties. See Section D, Landscape Plan • Tree preservation zone is established to protect these stands of existing plants. See Section D, Landscape Plan. Temporary construction fence, minimum 4’ in height, to be installed around the perimeter of the tree preservation zone prior to any construction activities. • No building, structure, patio, recreational or athletic facility, or any other improvement to be placed temporarily or permanently upon, in or under the area designated herein as Page 17 of 40 a “Tree Preservation Zone” nor shall any work be performed therein which would alter the natural state of the zone or damage trees or vegetation therein. • Disturbance of any part of the zone by maintenance is to be restored as nearly as practicable to the original condition. No tree or vegetation is to be removed from the zone except for the removal of dead, diseased, decayed, structurally dangerous or noxious trees or other vegetation, in keeping with sound arboriculture practices and is to be managed by the HOA. c. Tree Reforestation: • Upon completion of any removal of trees as described above, a tree reforestation program is proposed. Good quality trees being necessarily removed to accommodate needed infrastructure are to be replaced in accordance with City of Dublin tree replacement policy. • A mixture of largely deciduous trees of various sizes will be installed where appropriate in order to augment, re-establish or create a reinforced buffer between the development and surrounding neighborhoods. This reforestation buffer will have an unmaintained natural understory (no manicured turfgrass). 1. On an as-needed basis, trees or other vegetation may be removed from any buffer area in order to maintain mandated drainage facilities. 2. Street trees and other plantings in the public domain are to be a mix of varieties and sizes of indigenous and/or improved varieties of indigenous plants. “Ornamental” plantings are to be considered in limited shrub/perennial planting areas only. 8. Architecture General Character: The character of the development is to be 1.5 and 2 story single-family, high-quality homes with 2 or 3 car garages with possible auxiliary structures that complement the quality of the surrounding homes in adjacent neighborhoods and will adhere to the City of Dublin Residential Appearance Standards Code. The architectural vocabulary set forth shall align with that of Midwestern Vernacular and European Country to keep consistent within the surrounding context. Midwestern Vernacular architecture developed over the mid- to late 19th and early 20th centuries, drawing inspiration from a variety of styles. Greek Revival elements emphasize simplicity, permanence, and adaptability, while "farmhouse vernacular" showcases Gothic influences and vertical proportions typical of early Victorian designs. This architectural style reflects regional traditions, with notable examples found in Dublin as well as in communities like Bexley and Upper Arlington. European Country – The European Country style is defined by its use of stone and stucco cladding, along with deep-set doors and windows, steep roof pitches, and flared eaves. Its forms are typically simple and rectangular, featuring tall, well-proportioned windows that create a clean and elegant aesthetic. The 1.5 to 2 story adaptation of this style to this developemnt is thoughtfully designed to meet the demand for first-floor master living while harmonizing with the surrounding architectural character. Conceptual depictions of the representative architectural schemes are included herein. See Section D, sheets 13 &14 for benchmark photographic images of both architectural character/quality of Page 18 of 40 design and that of the streetscape/public domain. Below describes general understanding of materials, colors, forms and scale of the housing to be developed. • Development to be recognized as a holistic place, a complete neighborhood but will not be monochromatic in form, materials and colors. The common thread will be the quality of the designed architecture, the similarity in roof pitch and a palette of high-quality materials. • Each home to be distinguished by its own massing composition, front façade design, mixture of material types, and public realm landscape. • Garage orientation is to be determined in the context of individual site topography, configuration, existing preserved trees, jurisdictional restrictions and platted setbacks. Any front-facing garages will be set back from the front face of the body of the home. Ancillary “third car” garages may be provided, utilizing the palette of house materials and complementary massing with doors set back from the front face. • Lot configurations and topography may provide for non-traditional building siting including garage massing and orientation. Exterior Materials & Elements: • Cladding: Natural materials including full-depth brick, thin brick, stone, manufactured stone, wood, stucco, cementitious board or a combination of these. • Trim: Wood, cementitious board, aluminum (for gutters & downspouts only). • Color Selections: White, earth tones and other muted colors, paint and/or stain. • Roofing Materials: 25 year or above dimensional asphalt shingle (240 lbs/square weight), wood, slate, copper, standing seam metal and/or tile as architectural enhancements. • Windows: windows and doors (all 4 sides) will incorporate trim that is architecturally appropriate. • Architectural Elements: additional and specialty-shaped windows, louvers, shutters, entry coverings, and other architectural elements all in designed composition with the entirety of the structure in terms of forms, proportions, colors and placement. • Chimneys: exterior portions to be finished masonry of brick, stone or manufactured stone. Cantilevered chimneys are not permitted. • Garages: Architecturally consistent with the main building facade, decorative garage doors a maximum 18’ wide, in keeping with the overall architectural character of the home. Garage orientation to be determined in the context of individual site topography, configuration, existing preserved trees, jurisdictional restrictions and platted setbacks. Any front-facing garages will be set back from the front face of the body of the home. Auxiliary garages may be provided as freestanding structures consistent with the overall character of the home it serves. • Lighting: No more than one (1) approved yard post light is permitted near the entry walk to the front door. Properly designed & placed landscape/accent lighting is allowed and encouraged. • Patios: Outdoor terraces, decks, pool/dining areas are permitted as part of the overall architectural and landscape character of the home. • Mechanical Equipment: Ground-mounted equipment is to be located and screened through architecture and/or landscape to minimize visibility and noise as would be experienced by homeowner and neighboring homes. • Permitted Building Height: Maximum height of 35’, as per the Dublin Code. Page 19 of 40 Architectural Diversity: The same or similar front elevations shall not be repeated within: • Two lots on either side of subject lot. • Three lots directly across the street from the subject lot. • Any lot on the cul-de-sac. A themed or monochromatic development is not intended but adherence to architectural diversity (stated above), materials standards and design quality will be reviewed/approved by the Homeowners Association based on the standards herein approved by the Planning and Zoning Commission is dictated. Plan Approval: The Homeowners’ Association will retain the right of individual plan approval for all single-family homes within the development. The Homeowners’ Association established declarant will form an Architectural Review Board (ARB) to review all architecture in ensure compliance with or exceed the architectural standards set forth in the Development Standards. See Paragraph 10. Homeowners’ Association below for additional detail. 9. Landscape Street Trees: Street Trees will be installed in accordance with the City of Dublin Code. Final locations and varieties shall be as approved by the City Forester. Fencing: • Existing fencing along Bright Road may be repaired in-place, removed in select areas or in total. Long-term maintenance, repair or replacement to be the responsibility of the HOA. No other fencing is permitted unless decorative in nature and does not fully enclose an area, as approved by the HOA. • Pool Barriers shall be permitted and conform to the requirements of the governing building code. Appearance of all such fences to be as approved by the HOA. • Front yard fences, where so chosen by the homeowner, may be constructed of ornamental metal, painted/stained wood, stone, or a combination thereof in keeping with the character of the house design and as approved by the HOA for the purpose of describing but not enclosing the “semi-public” space that is the home entry area. Front yard fencing to be placed no less than 3’ and no more than 5’ behind the public sidewalk where provided and no less than 1’ and no more than 3’ behind the R/W line where no public walk is provided and is not to return along the side yards. • See Section D, Sheets 13 & 14 for benchmark photographic images representative of the character & quality of design envisioned for the public domain. All architecture of the development is to be custom with each their own distinct expression and materials palette. As such, elements of the public domain including fencing, paving, landscape, etc. to be coordinated as a cohesive composition. Cul-de-sac: The cul-de-sac island planting to be initially planted as a part of the project development and maintained by the HOA. Page 20 of 40 10. Homeowners’ Association All residential property owners located within this Planned Development will be required to join and maintain membership in the Homeowners’ Association (HOA) to be established by the Developer at Final Plat. HOA responsibilities are to be detailed within the Covenants and Restrictions that run with the land. Disposition of all Reserves within this Planned Development relative to ownership and maintenance responsibilities will be described as a part of the Final Development Plan The HOA will establish an Architectural Review Board (ARB) to evaluate each homesite and building plan in the development for compliance with the Development Standards put forth by the Final Development Plan. The Developer, as the sole builder of these custom homes, will serve as the ARB and retain control of individual homesite plan approval within the development until such time that all lots are constructed. At that time, the review/approval of modifications to existing structures and homesites will be by the ARB established by the HOA. Unless otherwise provided by Ohio law, control of the Homeowners’ Association will be ceded to the residents at a time determined by the Developer. Until such time, the Developer will pay dues and fees on the property owned by the Developer and subsidize budget shortfalls. Budgets will include line items for maintenance, reserves for repairs and replacements under the HOA 11. Ownership & Maintenance The following matrix describes spaces as currently identified, their anticipated ownership post- development and the maintenance of these spaces and their facilities. Final disposition of ownership including deed restrictions and identification of maintenance responsibilities, sole and shared, are subject to further conversation with the City of Dublin in Final Development Plan process. However, regardless of the results of those conversations, Reserve open spaces (including the stormwater management basin) are intended for public use and/or environmental protection, Landscape Easements are intended for the preservation of existing vegetation. Space Ownership Maintenance • Streets (Right-of-Way) City of Dublin City of Dublin • Stormwater basin/Maintenance Path (in Reserve A) City of Dublin City of Dublin • West Wood (Reserve A) City of Dublin City of Dublin • Billingsley Run (Reserve B) City of Dublin City of Dublin • Central Court (Reserve C) City of Dublin HOA • East Court (Reserve D) City of Dublin HOA • Landscape Easements (Preservation Areas) Privately held HOA Page 36 of 40 16. Concept Review Plans (for reference) The following information is a summary from the Concept Review phase of this project’s process, dated 5/15/24 and Planning & Zoning Commission Hearing dated 6/20/24. In addition to the narrative, plans and other supporting graphics submitted above for review, we are herein summarizing portions, in direct quotation and/or paraphrased summary of the Meeting Minutes prepared by Staff, of Commission comments, Public comments, Commission questions and discussions among Commission Members and with the Applicant. Additionally, Applicant is providing brief “responses” to each of these items, where appropriate, demonstrating understanding and consideration of all through written descriptions supported by the narratives, standards and descriptions submitted as a part of this Preliminary Development Plan and Preliminary Plat. This summary information is provided as a convenience to the Staff, Commission and the public as they consider the merits of this proposed development. Staff Presentation • Project site is currently located within the Suburban Rural Residential Land Use designation, according to the current Community Plan. o Agreed • Project site is within the Residential, Low Density Future Land Use designation within the Envision Dublin Community Plan that is now in the adoption process. o Agreed • Proposal will require rezoning to a Planned Unit Development (PUD) that includes 20 single- family lots on the 14 acre site, 1.4 du/ac. o Agreed • There is a focal point with Lot #7 that may need to be addressed o Current layout has modified lot layout in this area in response to Commission and neighborhood comments. However, the “focal point” of the Main Drive alignment is to be addressed by a landscape feature in keeping with the development character to terminate the view. • The development is eligible for the Conservation Design Resolution. o Agreed and is being pursued • The development will also need to follow the Neighborhood Design Guidelines o Agreed and is being pursued • The stormwater detention would result in the removal of some of the tree canopy o Agreed, yet the detention area in the West Wood is being carefully and strategically located, configured and graded to impact as FEW “Good” trees as possible with the majority of trees being impacted/removed are of “Fair” or “Poor” quality. Commission Questions Mr. Way Requesting additional description of the stormwater detention proposed in the West Wood area. Inquired if the area would include intentional stormwater retention areas. • This area will provide both stormwater management and public open space. The detention area will not only satisfy the management needs of the entire development but will also over-compensate for storage from the free-draining neighborhood to the north, which currently passes thru the development site. This storage area will be in a “dry basin” with a controlled release devise discharging into the currently utilized Page 37 of 40 outflow swale running west to the river. The basin is to be configured, graded and landscaped to be an integral part of this West Wood area, being developed at a publicly-used park, complete with amenities for users. See attached development plans for a graphic depiction of this space. Center Court to incorporate a roundabout drive or if it could have a road on only one side. It could be improved by having less concrete or asphalt. Intention of Center Court for stormwater detention. • The Central Court continues to have a publicly-dedicated drive on all sides. This condition, along with the internal roadway/walkway system, provides for pedestrian and bicycle user access to the functional community green space it provides. However, it is desired that the west leg of this court roadway system be as modest in width (servicing only TWO homesites) as is practical for vehicle/safety vehicle usage. The current proposal suggests a flush curb on the inside of this loop, paver parking “pads” for visitor parking on this side (without having to increase road width unnecessarily), encouraging direct pedestrian access to the open space but providing for proper radius dimensions of fire vehicle function. Agreed on the latter point of less pavement! Always the goal! Furthermore, the Central Court is no longer to be used for stormwater management, but strictly as public community open space. • Perimeter trees in the West Wood (in Fair and Good condition) are intended as a landscape buffer and will be protected at the drip line of those trees. o Yes! The level of tree removal and the basin layout/grading will be dictated by storage demands as required by Engineering. And the quality of trees to be considered in that effort, part of Final Engineering of the storm system. No more trees than are necessary for this system are proposed for removal and all remaining trees will be properly protected per sound arboriculture practices. Ms. Harter If the detention area is to be usable greenspace, would the grasses be coarse and less friendly play area? • Current thinking for the basin is that it would have a planted bottom/sides for erosion protection. Further, there may be other plantings incorporated to help naturalize the area (ie: trees/shrubs that don’t adversely effect storage volumes), diversify the plant community and add to the aesthetics of the entire area. It is not anticipated that this area be manicured lawn requiring regular mowing due to its water storage function which may leave the bottom wet for some period of time after a rain event. But, this area will certainly be available to wildlife, pet usage, and general “passive” park functions, aesthetics and amenities. Sidewalk on one side of the interior street be wider than a typical walk? • Presently, the sidewalk is proposed as 4’ wide and built of specialty pavement (brick, precast concrete) to better blend with the intent and character of the development (intimate streetscapes, homes closer to the street, rich materials, “hamlet” character vs “subdivision”). This provides for more green areas in the streetscapes vs pavement that is unnecessary. Given the modest scope of the development (only 20 homesites), a single sidewalk will provide pedestrian access from/to every lot and destination, especially given the extremely low traffic volumes in and around the development making casual street crossing very easy. This system of roads/walks is not interconnected to other surrounding developments (surrounded by built-out neighborhoods), thereby eliminating any off-site traffic. If additional width and/or walks are to be required, pavement materials will likely revert to cast-in-place concrete, due to project budget. Page 38 of 40 Will garages be 3-car and side-loaded? • Attached or detached garages will be 2, 2.5 and 3-car in size are intended to be side loaded as the preferred orientation and/or will be oriented to minimize garage door exposure to/from adjacent streets. Lot layout of this development is unconventional due to natural areas being preserved, drainage/floodway, existing trees and site topography dictating that house/garage layout, placement, orientation will be customized and sensitive to all of those conditions on a per-lot basis. Additionally, some homesites may contain auxiliary, additional-car free-standing garages as well. Development Standards to dictate placements and orientation. Homes to have individualized landscape, a type of green architecture? • Yes. The public realm of this development os paramount to its character. The streetscape, home placement, front yard/entry zone are all to work in concert to create the intimate village feel. Development Standards speak to the front entry zone, yard landscape, lighting, semi-private enclosure (low hedge, wall, fence). Each house to have landscape design reflective/supportive of the architecture and vice versa. Mr Alexander Some traditional rear-yard recreation space is being sacrificed to have more frontage • No. The front setback is proposed to be 15’ and R/W throughout most of the development to be 40’ for sake of 1. Intimacy of streetscape (see above) and 2. Provide for more rear yard for recreation/social life, gardens, drainage, screening if desired. Typical Lot diagrams herein illustrate the special qualities of those areas. Mr Chinnock A bikepath is indicated in the Billingsley Run area. • No. At Concept Review stage, a soft-surface trail was considered through this area. But, given the environmental sensitivity of this area, its flood prone conditions and desire to preserve every tree in this street corridor and along the north side of Bright Road, even this soft-surface trail is being eliminated and the entire area is to be left in its current condition. Agreed, no need to provide connection from soft-surface trial. Similar trail indicated in the West Wood. • Agreed that soft-surface trail on the east side of the development is no longer proposed. The trail in the West Wood, an intentional passive park space by this proposal, will have that trail lead to Bright Road for direct access to the Wright- Holder Park on the south side of Bright Road. It is important to note that Bright Road is NO LONGER connected to Riverside Drive, there are only SEVEN single family homes west of Grandee Cliffs Drive that utilize Bright Road for access to their homes and a 25 MPH post speed resulting in a very low traffic volume which allows for ease of safe crossing access to the Wright-Holder Park. Mr Deschler Central Court to be a mowed areas or include some stormwater management? Page 39 of 40 • The current proposal eliminates stormwater management from this area and reserves it as more manicured and usable public open space. Possible for Central Court to be manicured space? • Yes! See above. It is preferable to avoid need for homeowner variances later to add rear yard structures. • Agreed. Development Standards accommodate such structures and the Typical Lot diagrams included herein demonstrate this private space layout. Why 20 homesites vs 14? • This proposal preserves naturalized open spaces as is possible, trees on edges, accommodates/manages on and off-site drainage and embeds public-use space within the development. Further, homesites proposed are “estate” size, meeting the market demand for this housing type. 20 homesites “fit” comfortably into this development zone and project economics require this number of lots. Ms Call How will you treat Lot #7 at the terminus of street entry? • Current layout has modified lot layout in this area in response to Commission and neighborhood comments. However, the “focal point” of the Main Drive alignment is to be addressed by a landscape feature in keeping with the development character to terminate the view. Public Comment John Rahm Biggest concern are the 7 homesites along the north boundary “in a straight line”. Consider larger lots there providing more greenspace. • Agreed. Current plan has removed one lot along this line, increased depth of those lots remaining and have reconfigured the street alignment and lot lines to eliminate the straight line geometry of the Concept Plan. Further, the Applicant has met with Mr Rahm and other on his neighbors to address this and other issue and have gained their support. Randy Roth Thanked the Applicant for meeting with the East Dublin Civic Association in May, 2024 and several times with association officers. One concern was landscaping along the development’s north property line. Very happy with proposed landscape and existing fence repair along Bright Road. Turning undevelopable areas into an amenity for residents and neighbors is generous. He has seen much enthusiasm for this project. • Agreed. Current plan has addressed the concerns of Mr Roth and the association. See above response. Applicant appreciates the attention paid and great comments given by the association and neighbors. The over-riding goal of this development is to fit into and elevate the neighborhood that it is to be a part of. Page 40 of 40 Commission Discussion Mr Chinnock Very nice use of site. Appreciates Applicant meeting with neighbors, very good job in creating a plan that will fit the site, greenspace is great. Inspirational architecture is beautiful, wants to make sure it blends with surrounding area. Understands the economics that drive the ned for 20 lots, applicant’s vision makes sense of the space. Mr Deschler Supportive of the proposed use and building materials. Believes Central Court open space should not be used for stormwater detention purposes. Recommends to alleviate straight row of houses along north perimeter. Perhaps some homes can have walk-out level, some variation to the look. Mr Alexander Very supportive, even enthusiastic about the plan. Less concerned about architecture matching the surrounding neighborhood, which were built at a different time. Creating community is more valuable. Central Court to be more about usable public space. Mr Way Very exciting proposal, great example of city’s Conservation Design Guidelines implemented, responsive to sensitive nature of the site. Encouraged preservation of trees and sufficient setback on north edge of the site. Hopeful that Applicant and neighbors can work out something to meet that intent. Applicant should look at facing homes to Bright Road, not disengaging from it, creating an urban design feel to the development could be spectacular. Ms Harter Supportive of the proposal, appreciates Applicant meeting with the association, encourage to keep the green tree look along Bright Road, even the brown fence. Appreciates Applicants efforts to use landscape and architecture to create outdoor living space. Ms Call Look for lot deletion on center section and along “back section” (north boundary?). This is a beautiful project- not what we see everyday. PLANNING ▪ LANDSCAPE ARCHITECTURE ▪ URBAN DESIGN To: Rati Singh, Assoc. AIA Planner, City of Dublin From: Dan Phillabaum, AICP, RLA Landplan Studios, LLC Date: January 30, 2025 Re: 24-135Z-PDP—Bright Road Reserve Neighborhood Design Guidelines Analysis Rati— This memo provides a chapter-by-chapter comparative analysis of the proposed Bright Road Reserve Preliminary Development Plan to the objectives and recommendations of the Neighborhood Design Guidelines, as is applicable to all future residential PUD developments in the City. The objectives of the Guidelines pertinent to this PDP application have been summarized into the following table, followed by my analysis and recommendations for the specific objectives, provided in italic bullet points. I. Public Realm—Macro Level Design Guidelines A. Open Space Framework 1. Step One—Site Inventory and Analysis The significant and pertinent existing features of the site are inventoried and analyzed. The quantitative or qualitative outcomes of each step of the inventory and analysis are overlayed to illustrate the interplay of these features and their impact on the site layout. ▫ A site inventory and narrative analysis of the various site features has been provided through the combination of Exhibits and Project Narrative provided which describes the significance, or potential influence, of each of the existing conditions in the site planning process. ▫ An overlay exhibit of the site inventories has been provided which depicts the interplay of the existing features that leads to Step Two—Identification of Significant Features & Development Areas. 2. Step Two—Identification of Significant Features & Development Areas Identify proposed areas to be preserved, including significant natural features, historic or cultural resources and potential locations for new open spaces. Identify areas of the site conducive to residential development and provide the acreages of development and preservation areas. ▫ The location and acreage of proposed preservation areas and new open space areas has been provided, along with the areas of the site conducive to residential development. 3. Step Three—Conceptual Street and Path Network Delineate the conceptual locations and hierarchy of streets through the neighborhood and path network linking open spaces. At a site context level, depict path connections to points of interest in the area.  The proposed street network has been fully delineated, along with the sidewalk system along the street. The proposed path network into the preservation areas and open spaces has been mostly depicted. ▫ There is no perceived street hierarchy based on the minimal difference between the proposed street types. This is appropriate given the limited size of the proposed neighborhood and lack of connectivity to other neighborhoods afforded by the existing site conditions and context. ▫ Additional details should be provided regarding the proposed recreational path system through the West Wood. 4. Step Four—Refine Development Areas with Lot Lines Within the areas proposed for development, incorporate lot lines and other regulatory boundaries necessary to convey the lot/dwelling types proposed. ▫ Lot lines have been incorporated along with proposed setbacks for the single dwelling type proposed. B. Design Objectives—Preservation of Significant Existing Features The preservation of existing natural features should be given highest priority as dedicated open space in the layout of the neighborhood. These should be embraced as public focal points of the neighborhood and may serve as the basis for the neighborhood identity.  The predominant preservation areas are the Billingsly Run floodway and surrounding woods at the east side of the site and the wooded area at the west side of the site— the ‘West Woods.’ The location of these preservation areas focuses development sites in the middle portion of the site, with homes backing up to the preservation areas. ▫ The overall open space network of preservation areas, newly created open spaces, the streetscape and the open portion of the cul-de-sac right-of-way form a connected open space network across the site, with relatively convenient access to open space from all proposed lots. C. Design Objectives—Creation of New Public Open Spaces New open spaces should be coordinated with preservation areas to provide a series of opens spaces strategically and equitably distributed through the neighborhood. Open spaces should have public street frontage and homes facing the open space. New open spaces may be formal or informal, have a variety of sizes, and programmed to respond to the recreational needs of the neighborhood.  The Central Court is a newly created open space in the central portion of the lot surrounded by street frontage and with homes facing the open space. The Central Court is a gathering space for residents and provides an open space connection to the West Wood natural preservation and stormwater detention area. The conceptual design includes a perimeter sidewalk, clusters of birch trees and a central mail facility.  The Allee is a formal open space between Lots 4 and 5 linking the Central Court and the West Wood. The design includes a recreational path lined with an allee of ornamental trees. At the western terminus of the Allee a small gathering space is proposed overlooking the stormwater detention area. ▫ The Central Court and Allee both meet the design objectives of the Neighborhood Design Guidelines for the creation of new public open spaces. D. Design Objectives—Stormwater Management Facilities The Neighborhood Design Guidelines only consider dry stormwater detention facilities as contributing open space when these areas achieve a superior and interactive design as useable open space when they are not intermittently put into use for stormwater management.  The proposed detention basin within the West Wood is described in the Development Text as “a dry basin to be shaped, planted and protected as an open space Reserve. In light of its location relative to existing surrounding neighbors who abut this Reserve, it is the intent of this development proposal that Reserve A is to remain passive in use and nature with no additional programming, hard-surface trails, park apparatus, etc. for the entire neighborhood’s continued quiet enjoyment of the greenspace.”  The proposed Preliminary Development Plan exhibits depicts pedestrian paths leading to the stormwater facility from the Allee open space as well as from Bright Road at the southwest corner of the site across from the Ferris-Wright Park and Earthworks. ▫ Further details and clarifications are needed as to the degree of pedestrian access proposed to and around the stormwater facility and larger Reserve. Thaddeus Kosciuszko Park is cited as a precedent for the type of passive public open space proposed with the West Wood, however the design of this existing park includes parking for autos and bicycles, a gazebo and an extensive trail system. E. Design Objectives—Perimeter Setbacks as Open Space Only perimeter setbacks from external collectors or arterial roadways may be counted as open space under the following conditions. Homes shall either front roadway setbacks that are designed as linear, park-like environments with shared-use paths, or homes may back up to the roadway setback with views of the rear of homes screened with landscaped, earthen berms and meandering shared-use paths through the setback area.  Lots 1, 2, 13 and 20 back up to the Bright Road right-of-way and a minimum 20 foot wide Rear Setback/Landscape Easement and No Build Zone to the Private Open Space is proposed on these lots along the Bright Road frontage.  There is existing vegetation in this area of the site that is proposed to be preserved and augmented within the 20’ Landscape Easement. ▫ The addition of mounding to screen the rear of the proposed homes cannot be accommodated within this area, and the shared use path is located on the opposite side of Bright Road. The existing vegetation, fencing and proposed reforestation/augmentation of this landscape buffer will effectively screen the rear of these homes from Bright Road. ▫ The Development Text should clearly state that vehicular access to these lots from the Bright Road right-of-way is prohibited. II. Public Realm—Micro Level Design Guidelines A. Streetscape Elements 1. Design Objectives—Pedestrian Realm The Neighborhood Design Guidelines seek to establish a hierarchy within the street network using medians, variable tree lawn widths, and incorporation of a variety of landscape materials in the streetscape. Existing tree stands and tree rows can be captured within the right-of-way, and varying the planting scheme for street trees can create a unique character for different parts of the neighborhood and further assist in wayfinding. Monocultures of street trees are to be avoided.  Due to the size and isolated nature of the proposed neighborhood, the proposed street hierarchy is limited to two street widths. ‘Street A’ is a 50-foot-wide right-of- way extending from the Bright Road intersection to the first internal intersection, transitioning to ‘Street B’, a 40-foot-wide right-of-way.  The ‘Street A’ design section features two travel lanes totaling 26 feet, and ‘Street B’ two travel lanes totaling 24 feet. On-street parking is proposed to be permitted on one side of both street types. ▫ Where vehicles are parked on one side of these streets, the overall travel width is reduced to 15 to 17 feet and may require one vehicle to yield to another oncoming vehicle. Given the lack of through-traffic in the neighborhood and limited number of lots, and low travel speed these street widths may be appropriate.  A five-foot-wide sidewalk at the back of the right-of-way is proposed adjacent to a tree lawn on the east/interior side of ‘Streets A and B’ and terminating at the cul-de-sac, and around the perimeter of ‘Reserve C’ at the back of curb. ▫ Typically, pedestrian facilities are incorporated on both sides of neighborhood streets to the benefit of all residents.  The proposed tree lawn width between the sidewalk and the curb varies from 6.5 feet to 2.5 feet in width on the Preliminary Plat/Preliminary Development Plan exhibit.  The Development Text states that Street Trees will be installed in accordance with the City of Dublin Code, and also notes that “Street Trees and other plantings in the public domain are to be a mix of varieties…”. ▫ A diverse mix of naturalistically planted street trees is appropriate to the character of the site. However, the space available in the proposed tree lawns would not meet the minimum distance requirements of Code and is unlikely to be sufficient to support the long-term health of the street trees. B. Design Objectives—Semi-Private Realm Front yards should function as both a transitional space between the sidewalk and the front façade of the home and as contributing to the larger linear open space network within the streetscape. 1. Front Yard Landscaping Front yard landscaping should create a high-quality arrival experience unique and complementary to the design of the home, with consistent thematic elements shared by lots on the same street for a unified streetscape character. Where short setbacks are proposed, hedges at the edge of the public sidewalk should be incorporated. Where larger lots are proposed, attention should be given to the arrival experience between the driveway and the front door created by the landscape design.  Per the proposed Development Text, “each is home to be distinguished by its own public realm landscape”, “possibly including masonry piers for space definition”. “Each homesite will have a well detailed front yard with entry garden that defines the semi- private space of the yard through plantings, walls/piers, fencing segments and other devised to add to the character of the home.”  Front yard fences are permitted by the Development Text to define, but not enclose, the semi-public space of the home entrance. Fences are proposed to be permitted no less than 3 feet and no more than 5 feet behind the public sidewalk, where sidewalks are provided, and no less than 1 foot or more than 3 feet from the right-of-way elsewhere. Front yard fences are not to return along the side yards. ▫ The incorporation of fences, walls, and piers is consistent with the Neighborhood Design Guidelines recommendation for homes where short setbacks are proposed. In this neighborhood, the minimum front setback is 15 feet. ▫ No specific front yard planting requirements are proposed by the Development Text. Additional detailed requirements must be provided at the Final Development Plan. ▫ To provide more flexibility in the siting of driveways and homes, and to provide a larger area within which to establish a public realm landscape theme, Lots 2, 5, and 13 should be slightly widened at the front property line, in coordination with staff. 2. Transitional Arrival & Entry Spaces Architectural extensions at the dwelling entrance should be included to provide a transitional space between the public realm and the front door. These spaces must also function as useable outdoor space for the residents. The design of these spaces should highlight the primary entrance to the dwelling unit and be located at a comfortable conversational distance from the public sidewalk.  Per the Preliminary Development Plan exhibits, all homes are to be custom designed to conform to the conditions, topography, configuration and restrictions of its lot. No specific architectural plans have been provided. ▫ To ensure that this objective of the Neighborhood Design Guidelines is met, it is recommended that provisions be included in the Development Text to ensure that the main entrances be designed as useable spaces that are prominently located in relation to the street. 3. Architectural Composition, Diversity, and Materials The facades of dwelling units are the most character defining element of the streetscape. The dwellings should have a timeless, high-quality design, with massing and details at a pedestrian-scale which contribute to the overall character of the streetscape. Where a range of dwelling types are proposed, varying dwelling types along the same block face is encouraged as a means to provide variety and visual interest. The massing and articulation of dwellings, and a variety of exterior materials should provide architectural diversity to the streetscape. Exterior cladding materials should be long-lasting, low- maintenance and repairable over time.  Per the Preliminary Development Plan exhibits, all homes are to be custom designed to conform to the conditions, topography, configuration and restrictions of its lot. No specific architectural plans have been provided.  The proposed Development Text states that the single family detached homes will be high quality, 1.5 to 2 stories in height with 2 to 3 car garages and with possible auxiliary structures, and that the proposed homes will complement the quality of the homes in surrounding neighborhoods and adhere to the Residential Appearance Standards.  Architectural Diversity is proposed, limiting the repetition of the same or similar front elevations throughout the neighborhood. ▫ The proposed intent to build custom homes designed in response to each lot, the commitment to an architectural diversity matrix, together with the garage location and orientation recommendations below meets the Neighborhood Design Guidelines objective of facilitating a high-quality streetscape. C. Design Objectives—Garages The presence of front-loaded garages should be minimized to the maximum extent possible to maintain high-quality pedestrian-oriented streetscapes. 1. Garage Location & Orientation Attached, front-loaded garages should be located a minimum of 20 feet behind the primary façade of the dwelling. Where side-loaded garages are proposed on lots narrower than 85 feet, garage doors are recommended to be located at least 10 feet back from the front façade of the dwelling to allow for landscape screening.  The Development Text states that “Garage orientation is to be determined in the context of individual site topography, configuration, existing preserved trees, jurisdictional restrictions and platted setbacks. Any front-facing garages will be set back from the front face of the body of the home. Ancillary ‘third car’ garages may be provided.” ▫ To ensure that the objectives of the Neighborhood Design Guidelines are met, minimum setbacks should be included in the Development Text for front and side loaded garages relative to the front façade of the home. 2. Garage Doors & Facades The design of garage doors and the façade of the garage surrounding the door can reduce the negative visual impact of front-loaded garages by reducing the size of doors, the number of doors that may be on the same plane. The detailing of the garage doors and elements surrounding the door can further diminish the visual impact of garages to the streetscape.  The Development Text states that “Garages will be architecturally consistent with the main building façade, with decorative garage doors a maximum of 18 feet wide. ▫ This is consistent with the Neighborhood Design Guidelines objectives. III. Private Realm A. Design Objectives for Lot Elements 1. Front Building Setback Lots 60 feet and wider should generally implement the standard front building setback. For all lot types, the front setbacks should be staggered along the block face to create variety along the streetscape.  The standard front setbacks based on 50’ and 40’ wide rights-of-way are a minimum of 30 feet based on the Subdivision Regulations. As proposed, Lots 2, 5, 10 and 13 have a minimum front building setback of 15 feet, based on the tapered configuration of these lots toward the right-of-way. All remaining Lots have a Front Build-to-Zone of 15 to 20 feet. ▫ Homes on the four Lots featuring a 15-foot minimum setback will likely need to be set back a distance greater than minimum required based on the narrow, tapered configuration toward the front of the Lots, and the practicality of siting a home on these Lots. To provide more flexibility in the siting of driveways and homes Lots 2, 5, and 13 should be slightly widened at the front property line, in coordination with staff. ▫ Although the 15-to-20-foot Front Build-to-Zone may result in staggered setbacks among adjacent lots, there is no requirement in the Development Text to do so. 2. Side Yards The appropriate side yard widths will vary based several factors--the overall lot width, the width of the front facade of the dwelling relative to the lot width, and the prominence of the garage in the design of the front façade. Side yards should be wide enough to allow for positive drainage between adjacent dwelling units, and in no case should the minimum side yard be less than six feet wide on one side and a total side yard width of 14 feet on both side for detached dwelling units. Where six-foot side yards are used, AC units should be located in the rear yard.  The proposed minimum side yard dimension as outlined in the Development Text is 6 feet on one side and 14 feet total. On the Preliminary Development Plan exhibit the minimum side yard dimension depicted is 6 feet on both sides. ▫ The Neighborhood Design Guidelines recommend that in no case shall the side yards be less than 6 feet on one side and 14 feet total. No information has been provided about the typical width of the homes proposed to be constructed, but lots of this width typically have greater minimum and total side yard dimensions than proposed. 3. Maximum Buildable Depth/Buildable Area The maximum buildable depth on each lot from the front building setback should be provided to ensure that adequate space remains at the rear of the lot for private outdoor space. The maximum buildable depth will vary based on the dwelling type proposed and should be provided with each building type proposed as part of the Preliminary Development Plan application. 4. Rear Yard Minimum rear yards ensure that adequate space is reserved for private open space. Private open space should be provided with each dwelling unit and is defined as the space between the maximum buildable depth and the minimum rear yard. 5. Private Open Space Area The private open space area defines the physical envelope of the lot where decks, patios, hardscape, seat walls, pools, play equipment, and other outdoor improvements may be constructed. To ensure that a minimum amount of private open space is provided with each unit type proposed, the maximum buildable depth of the primary structure on the lot must be indicated on the Lot Type Examples submittal. The typical minimum amount of private open space on any lot should not be less than 150-square feet, with a minimum dimension of 10 feet. The actual amount required will vary based on the dwelling type and be determined by City of Dublin staff and the Planning and Zoning Commission.  The Development Text proposes a range of dimensional requirements for Maximum Buildable Depth, Rear Yards, and Private Open Space Areas which are tailored to specific lots based on the lot configuration. ▫ There are a number of inconsistencies in the numeric standards proposed for several of the lots for these elements, such that the numbers do not add up correctly. Revisions will be required to the Development Text to ensure that adequate depth is available for both the buildable area of the house and private open space while maintaining a minimum rear yard buffer to the adjacent lot. 6. Lot Coverage Code requires that in residential Planned Unit Developments, lot coverage is not permitted to exceed 45%. Higher lot coverage should be reserved for dwelling types not presently available and which meet or exceed the high architectural quality of existing housing stock in the city.  The maximum lot coverage proposed is 45%. ▫ The proposed lot coverage is consistent with other similar sized lots within the City and the Neighborhood Design Guideline recommendations. B. Lot Type Examples Diagrammatic examples of all of the proposed lot/dwelling types proposed should be provided. Lot Type Diagrams should not be depicted in isolation, but as a cluster of the dwelling type to convey the larger development pattern that the dwelling type will create.  A single dwelling type is proposed—detached single-family residences, on lots with an average area of 13,623 square feet. Conceptual Lot Diagrams have been included for several lots in isolation, as well as a row of conceptually developed lots reflected as a streetscape character elevation. ▫ The Lot Type Examples provided depict the smallest lot proposed (Lot 19) and a walk-out lot (Lot 12) conceptually developed at the maximum lot coverage permitted, as well as Lots 2 and 5 which are corner lots with minimal street frontage. ▫ The Lot Type Example exhibits effectively depict a range of conceptually developed lots, as recommended by the Neighborhood Design Guidelines. As noted several of the dimensional discrepancies must be revised in the proposed Development Text. In reviewing the submitted application materials, it is my opinion that minor revisions are required to both the proposed Development Text and Preliminary and/or Final Development Plan exhibits to resolve discrepancies between these documents. Additionally, more specific regulations should be provided in the Development Text as noted in the analysis and in coordination with staff to ensure that various objectives of the Neighborhood Design Guidelines are achieved. I would be pleased to discuss any of these items with you in greater detail at your convenience. Please let me know if you have any questions. Sincerely, Daniel Phillabaum, AICP, RLA Owner | Landplan Studios, LLC Office: 614.567.2000 Mobile: 614.327.5524 E-Mail: dan@landplanstudios.com SUMMARY OF ACTIONS Planning & Zoning Commission Thursday, June 20, 2024, 6:30 p.m. MEMBERS PRESENT: Rebecca Call, Kathy Harter, Kim Way, Jamey Chinnock, Gary Alexander, Jason Deschler MEMBERS ABSENT: Dan Garvin ACCEPTANCE OF DOCUMENTS/APPROVAL OF MINUTES   MOTION CARRIED 4-0 TO ACCEPT THE DOCUMENTS INTO THE RECORD AND APPROVE THE PZC REGULAR MEETING MINUTES OF 05-23-2024 (Mr. Alexander and Mr. Deschler abstained.) CASE REVIEW Case #24-075CU – Round Table Request to allow an Entertainment and Recreation use in an existing tenant space. The 10.89- acre site is zoned TF, Technology Flex and is located approximately 510 feet southwest of the intersection of Shier Rings Road and Shamrock Court. MOTION CARRIED 6-0 TO APPROVE THE CONDITIONAL USE Case #24-054FDP – Lightbridge Academy Request for review and approval of a daycare with associated site improvements. The 1.68- acre site is zoned PUD, Planned Unit Development District, The Corners, and is located approximately 270 feet west of the intersection of Frantz Road and Blazer Parkway. MOTION CARRIED 5-0 TO APPROVE THE TWO TEXT MODIFICATIONS (Mr. Alexander was recused.) MOTION CARRIED 5-0 TO APPROVE THE FINAL DEVELOPMENT PLAN WITH CONDITIONS (Mr. Alexander was recused.) Public Comment: None Next Steps: Submission of building permit. Case #24-069CP – The Farms at Cosgray Concept Plan review and feedback for 52 detached single-family lots and associated site improvements. The approximately 30.6-acre site is zoned R, Rural District and is located west of the intersection of Cosgray Road and Barronsmore Way. Planning and Zoning Commission Summary of Actions – June 20, 2024 Page 2 of 4 Commission members were not supportive of the proposed residential land use for this parcel, as it does not align with the Interim Land Use principles and recommendations of the Future Land Use designation and Special Area Plan for this parcel. Public Comment: A resident expressed concern about the location of the proposed residential development along the railroad tracks. Next Steps: A Preliminary Development Plan/Rezoning would be the next step in the process of creating a future Planned Unit Development. Case #24-073CP – Bright Road Reserve Concept Plan review and feedback for 20 single-family estate lots and associated site improvements. The 13.94-acre site is zoned R-1, Restricted Suburban Residential District and is located north of the intersection of Grandee Cliffs Drive and Bright Road. Commission members expressed support of the development proposal, finding it responsive to the natural features with the clustered layout. The members supported the architectural concept and recommended the architecture fit with the surrounding context and provide continuity within the development. They were appreciative that the applicant met with the neighborhood. The members recommended adding connectivity with the surrounding area, including the adjacent school and park. The Commissioners indicated that the central green space should be a focal point for the neighborhood and less about stormwater management. The members requested the applicant work to address the resident concerns related to provision of buffering adjacent to existing residential and look for opportunity to reduce the density. Public Comment: Several residents provided feedback about the proposal. The comments focused on the proposed density, limited buffering next to existing residential development, and current and future traffic challenges. The East Civic Association was represented and expressed appreciation of the developer and owner meeting with them and keeping them informed. The Civic Association expressed support for the proposed development and enthusiasm for the proposal. Next Steps: A Preliminary Development Plan/Rezoning would be the next step in process of creating a future Planned Unit Development. Case #24-055INF – Townes on Tuttle Informal review and feedback of a development consisting of 126 attached single-family units and associated site improvements. The 21.8-acre site is zoned R-1, Restricted Suburban Residential District and is located southwest of the intersection of Tuttle Crossing Boulevard and Hirth Road. Commission members recognized the opportunity for development to occur on the site, but expressed concerns about the proposal. They were not supportive of the proposed layout MEETING MINUTES Planning & Zoning Commission Thursday, June 20, 2024 CALL TO ORDER Chair Call called the meeting to order at 6:30 p.m. in Council Chamber and welcomed everyone to the June 20, 2024 Planning and Zoning Commission meeting. She stated that the meeting also could be accessed at the City’s website. Public comments on the cases were welcome from meeting attendees and from those viewing at the City’s website. PLEDGE OF ALLEGIANCE Ms. Call led the Pledge of Allegiance. ROLL CALL Commission members present: Rebecca Call, Jamey Chinnock, Kim Way, Kathy Harter, Jason Deschler, Gary Alexander Commission members absent: Dan Garvin Staff members present: Jennifer Rauch, Bassem Bitar, Thaddeus Boggs, Daniel Klein, Tina Wawszkiewicz CHANGE TO AGENDA ORDER Ms. Call stated that the agenda order would be revised to move Case 24-055INF – Townes on Tuttle, to be heard second on the agenda.   ACCEPTANCE OF DOCUMENTS Mr. Way moved, Ms. Harter seconded acceptance of the documents into the record and approval of the May 23, 2024 meeting minutes. Vote: Mr. Chinnock, yes; Ms. Call, yes; Ms. Harter, yes; Mr. Way, yes; Mr. Alexander, abstain; Mr. Deschler, abstain. [Motion carried 4-0 with 2 abstentions] Ms. Call stated that the Planning and Zoning Commission (PZC) is an advisory board to City Council when rezoning and platting of property are under consideration. In such cases, City Council will receive recommendations from the Commission. In other cases, the Commission has the final decision-making responsibility. Anyone who intends to address the Commission on administrative cases must be sworn in. Ms. Call swore in staff and audience members, who anticipated providing testimony. Planning and Zoning Commission Meeting Minutes – June 20, 2024 Page 9 of 29 Ms. Call stated that looking at the area comprehensively, there is some work needed on this plan. Although MI Homes is proposing the residential component of the mixed use anticipated here, there may be opportunity to look at a development text for a Master Plan for the entire parcel. MI Homes could develop the residential component, and a commercial or retail developer could develop the corner piece. Comprehensively, we could look at opportunities to plan and activate the open space; bring amenities to the residents and the City as a whole; and address traffic and safety concerns. The Commission is also challenged to look at the public realm. The City wants to protect its green spaces and the wild life, but also have it be usable; it wants to encourage walkability. Private roadways in developments are an issue. Because they are not built to the same standards as public roads, the City cannot later assume responsibility for them. She inquired if the applicant needed further clarification from the Commission. Mr. Underhill responded that they appreciate the comprehensive comments offered. Case #24-073CP – Bright Road Reserve A Concept Plan review and feedback for 20 single-family estate lots and associated site improvements. The 13.94-acre site is zoned R-1, Restricted Suburban Residential District and is located north of the intersection of Grandee Cliffs Drive and Bright Road. Applicant Presentation Bill Adams, 8824 Dunsinane Drive, Dublin stated that he has been a resident of Dublin for 30+ years, and his children graduated from Jerome High School. His real estate career began in Dublin with Jim Pickett, who had an office in Metro Center. He has completed numerous projects throughout Dublin. Specifically, in east Dublin, He was VP of Development for Dublin Village Center and Campden Lakes, working with his father, Howard Adams. He stated that the development team consists of Brian Kinzelman, MKSK, Planner and Landscape Architect; Joe Aleno, President, Corinthian Builders; Tom Warner, Advanced Civil Design; and Brian Kent Jones, residential architecture consultant. Brian Kinzelman, 462 S. Ludlow Street, Columbus stated that he and Mr. Adams have been looking at this site for 3-4 years. It is tailor made for the proposal they will show to the Commission tonight. It is a beautiful site with challenges, but its natural features are wonderful. It is within a beautiful neighborhood on a beautiful street that has very little traffic now that Bright Road does not go all the way to Riverside Drive. It is a prime time to fit some beautiful residential development into a beautiful neighborhood. The Billingsley Run woodlot is on the east side of the site, and the West Wood lies on the west. The West Wood receives drainage from the residential development to the north. In the center of the site, there was once a single-family home, which recently was demolished. A swimming pool and garage remain on the site, as well as the driveway that led back to the home site. The development will be placed in the center portion of the site, preserving the two wooded areas and the perimeter greenspace. They have done a tree study, and the perimeter tree stand is of high quality; the middle trees less so. The trees along Billingsley Run are magnificent. They are in the floodway, the stream corridor protection zone, so will be preserved. They were attracted to the site due to its natural features, the rural landscape of the surrounding neighborhood, and the culture and history of Dublin next door to the site. The latter includes the Mound Builders Park (Ferris-Wright Park) to the south, the riverfront to the west, and a short walk away, Bridge Park. The site is very well positioned in terms of what Dublin has to offer. The Bright Road street character is beautiful and quiet, once past the roundabout, as there is no through Planning and Zoning Commission Meeting Minutes – June 20, 2024 Page 10 of 29 traffic. The quality of life they anticipate will be spectacular. They anticipate having only 20 lots on this 14-acre site. The homes will be $1.5 - $2 million single-family homes, all developed in one phase with public roadways and utilities. The architecture will be controlled. Corinthian Fine Homes will develop the entire site with custom homes, themed as the Hamlet in the Park. Each home will have some distinct character but a commonality of materials and architectural forms and shapes. All of the homes will face the street with very well-tailored outdoor space, proverbial indoor-outdoor living with dining terraces, probably some swimming pools, spas and gazebos. They are big lots but are clustered. The home lots have frontages of 90-120 feet and lot depths of 110-140 feet. This is a Concept Plan, so much more design work is anticipated. The perimeter trees will be preserved. They do not anticipate this being a gated community or an encased community. It will be part of the neighborhood, not exclusive of it, but will preserve everyone’s privacy. Part of the West Wood will be used for stormwater management. They will extend the drainage from the subdivision to the north through the backyards of the anticipated homes, perhaps moving it through conduits to the Bright Road storm sewers. The central court of the development is an intentional greenspace; it is not a wide cul de sac. Stormwater management may be included in that center court, perhaps in a showcased manner. There are two watersheds on this site. The east court may be used for stormwater management, as well, with porous pavement and subsurface lines. There will be a gateway entrance at Bright Road, and they will incorporate an intimate streetscape with sidewalk on one side only. The development will have such low density, that they prefer to have greenspace on one side. That is not a cost issue, but a character issue. The greenspace along the frontage will be large fir trees augmented with under-story plant materials. They will also infill plants on the north property line, where there are gaps. Staff Presentation Mr. Bitar stated that this is a Concept Plan, so at this point, only nonbinding feedback is requested, no decision. If the plan moves forward, there will be a Traffic Impact Study (TIS) and stormwater and utility studies. The next step is a Rezoning and Preliminary Development Plan, which is then followed by a Final Development Plan. Mr. Kinzelman explained the site well, so he would not spend time on that, other than to say that it is located within the Suburban Rural Residential Land Use designation, according to the current Community Plan. It is within the Residential, Low Density Future Land Use designation within the new Envision Dublin Community Plan that is now in the adoption process. Both plans are generally similar with one-acre lots clustered to preserve greenspace. The proposal will require a rezoning to a Planned Unit Development (PUD) that includes 20 single-family lots on the 14-acre site, 1.4 du/acre. The entry drive will be in the same location as the existing driveway, which is in line with the street to the south. The entry drive will curve, allowing for natural views. There is a focal point with Lot 7 that may need to be addressed. The main entry drive would have a 50-ft. right-of way; the rest of the drive would be 40 feet, with sidewalk on one side of the drive. The preserves will be along the floodplain; Billingsley Run lies on the east side and the West Woods on the west side. The development is eligible for the Conservation Design Resolution. It also would need to follow the Neighborhood Design Guidelines. Both documents provide guidance on open space preservation. They do not completely align, so they will be looking for the solution that makes the most sense moving forward. For instance, the center court technically does not meet the requirements for the Conservation Design Resolution, so it will be looked at comprehensively. Similarly, the stormwater detention would result in the removal of some of the tree canopy, but the Neighborhood Design Guidelines do allow for stormwater within those conservation areas, as long as they are amenitized. The lot sizes will be 90-100 ft. x 110-140 ft. deep, so are smaller than the lots in the surrounding neighborhoods; most Planning and Zoning Commission Meeting Minutes – June 20, 2024 Page 11 of 29 of those lots were developed some time ago in a more rural setting. The applicant is proposing buffers along the site perimeter and Bright Road. The building materials are traditional – brick, stone and cementious siding. Each home lot will be different, but there will be a unified theme. The application mentioned thin brick, so that will be a future discussion point. Staff has provided the following questions to guide the Commission’s discussion: 1)Is the Commission supportive of the proposed use, densities, and lot types? 2)Is the Commission supportive of the proposed open space framework? 3)Is the Commission supportive of the proposed layout? 4)Is the Commission supportive of the proposed neighborhood theme and architectural inspiration? 5)Other considerations? Commission Questions Mr. Way requested additional description of the stormwater detention proposed in the West Woods area. Mr. Kinzelman responded that this area is the low end of the site, currently where the stormwater runs. They have inventoried the wood lot, and the arborist indicates only 27% if the existing trees are classified as good; the remainder are fair or poor. They believe they should be able to implement some stormwater management there. Both of the greenspaces on the site will be intentional, public park space, incorporating soft surface trails connecting to the sidewalk and street system. There will be 3 green easements, which will provide access to the greenspace without need to walk through backyards. Mr. Way inquired if the area would include intentional stormwater retention areas. Mr. Kinzelman responded affirmatively. They would like to incorporate a sunken basin that is landscaped, not a wet detention basin full of water. It will be a usable open space, which could include some casual seating areas. They do not intend to fence any of the site, not even the frontage. Mr. Way inquired if the center court would incorporate a roundabout drive or if it could have a road on only one side. Mr. Kinzelman responded that he believes that could be possible. This is the Concept Plan stage, so the roadways will be developed further. Their intent is to have intentional, manicured open space to serve as the central focus of the community. In the outer areas, there would be naturalized open spaces. The contrast between the two would be outstanding. Mr. Way noted that it could be improved by having less concrete or asphalt. Mr. Kinzelman responded that they would be having those conversations with Engineering. They are aware the street standards are being re-visited. They agree that more green is better than more gray. He is hopeful the center court will be curb-less. It is preferable that it be more like a parkway than a large cul-de-sac. Mr. Way requested clarification of the intent for stormwater detention in the center court. Mr. Kinzelman responded that the east court will have porous pavement; stormwater also may be captured in subterranean facilities. This is a smaller watershed than the larger one to the west. He will defer to Engineering on the matter. However, both drainage channels end up in the same place. Planning and Zoning Commission   Meeting Minutes – June 20, 2024 Page 12 of 29 Mr. Way stated that they have indicated the perimeter trees are nice and in good condition. Is the landscape buffer intended to protect the drip line of those trees or more? Mr. Kinzelman responded affirmatively. The property owner planted most of the trees in the clearing and certainly on the perimeter to provide a level of privacy. Now, what started as shrub are 20-ft. tall trees. The Spruce trees along the frontage have limbed themselves up over the years, and the tree stands need to be both trimmed and augmented. Ms. Harter stated if the detention area will be usable greenspace, would the grasses be coarse and a less friendly play area. Mr. Kinzelman responded that he does not believe the area will be manicured but will be low-lying native grasses. Ms. Harter inquired if the sidewalk will be on only one side of the interior roadway, it would be wider than the typical sidewalk. Mr. Kinzelman stated that they would defer to Engineering. If more sidewalk is indicated, they will install it. Ms. Harter inquired if the garages would be 3-car and side-loaded. Mr. Kinzelman responded that most of the garages would be side-loaded. There are different ways of orienting buildings on the outside corner lots. They will be 2-car garages, perhaps with an auxiliary third car bay or a cabana area for a pool, outdoor kitchen or gazebo. Ms. Harter inquired if the homes would have individualized landscaping, a type of green architecture. Mr. Kinzelman responded that there would be architectural and site design guidelines. Corinthian Homes will build each of the homes, so there will be tight architectural and landscape controls. The front yards are important, but the private space to the rear of the homes will be homeowner- determined. Some homeowners will want pools; others will want large dining terraces. Due to the topography, there may be some basement walkout opportunities. Mr. Alexander stated that the architect’s rendering indicates some of the home footprints will extend deep into the rear-yard setback. It looks like some of the traditional rear-yard recreation space is being sacrificed to have more frontage. Mr. Kinzelman responded that they have discussed that point, and are contemplating decreasing the front yard setback to bring the home footprints up to the street frontage to alter that sense of scale. That would provide more backyard space. He may need to alter the roadway system to create more backyard areas. He believes the future homeowners will be primarily empty nesters, dual-income, more interested in entertainment space than mown lawn areas. Mr. Alexander noted that this is a different site condition that is being proposed than the traditional neighborhood. He likes the wider lot widths. The garage need can be solved in different ways. Mr. Chinnock stated that a bikepath is indicated in the Billingsley Run area. It would seem to be a missed opportunity not to connect it to Hopewell Elementary School. Was that intentional? Mr. Kinzelman responded that there will be a soft-surface trail along the frontage and through all the greenspaces. At this juncture, they are not proposing any paved bike trail along the frontage of Bright Road, as there is no connection point. Mr. Chinnock agreed that there would be no need to provide a connection from the soft-surface trail. On the West Wood side, there is a similar trail that dead-ends at Bright Road. Planning and Zoning Commission Meeting Minutes – June 20, 2024 Page 13 of 29 Mr. Kinzelman responded that they want to get the soft-surface trail down to Bright Road. Right across the street is a park, which would be a great amenity for the future residents of this development. The neighbors would also be able to pass through this development, as well as potential users of the West Wood park area. He will defer to Engineering on the potential need for a crosswalk. Mr. Deschler inquired if the central court would be a mowed area or include some stormwater management. Mr. Kinzelman responded that in the Concept Stage, that is not yet determined, but he believes it may include stormwater management. If so, it will be the proverbial sunken garden, a low fescue grass area that could fill up with water after a thunderstorm. Mr. Deschler inquired if due to the topography, it would not be possible to have the large central court area be a manicured area. Mr. Kinzelman responded that it might be possible, if they can locate all of the stormwater management in the West Wood area, the low portion of the site. If that occurs, stormwater management would not need to be incorporated in the central court area. For maintenance purposes, it would be easier to have all of the stormwater facilities in one place versus two. Mr. Deschler stated that he concurs with Mr. Alexander’s observance about the limited rear yard space. It is preferable to avoid the need for homeowners to obtain variances later to add rear yard structures. Mr. Kinzelman concurred. Mr. Deschler noted that staff has indicated 14 home sites would be the preferred number on this site, rather than the 20 home sites currently proposed. Why does the applicant believe 20 home lots would be no issue? Mr. Kinzelman responded that the proposed lots are estate size. Their preference is to properly size the lots to the homes that will be placed upon them, and then to consolidate as much open space and preserve as much greenspace as possible. They would need to address specifically only the center court area. Finally, for the development to be economically feasible, they need to have a few more home sites on the site than the current zoning permits. Ms. Call inquired if the applicant had considered how they would treat Lot #7 at the terminus of the street entry. Mr. Kinzelman responded that he anticipates a key piece of architecture. They may pull the east- west road on the north side down somewhat and create more movement along the east-west roadway. The terminus piece may contain a landscape feature, such as a Dublinesque low stone wall. It is a great lot, and more thought will go into that element. Public Comment John Rahm, 4273 Hanna Hills Drive, Dublin stated that he lives directly behind this project. He has polled some of his neighbors. The biggest concern they have is that there are 7 homes extended across the back of the site in a straight line with a 20-ft. setback. The current condition he and his neighbors have is very nice with the Scioto Park, Thaddeus Kosciuszko Park, etc. They are nicely isolated. The developer is proposing to construct a row of houses across the back of the site. In Riverside Woods, a section of that development has only 2 homes within 30 feet of the Hanna Hills properties. Everything else extends at obtuse angles to the sides. They are asking that the applicant consider placing smaller lots at the front and larger lots at the back in order to provide Planning and Zoning Commission Meeting Minutes – June 20, 2024 Page 14 of 29 more greenspace between the properties. Randy Roth, 6987 Grandee Cliffs Drive, Dublin stated that he is vice president of the East Dublin Civic Association and is representing his neighborhood. The civic association was founded in 1987 as an umbrella organization to represent all of the residential neighborhoods east of the river that are within the City of Dublin. He would like to thank Mr. Adams and the property owner for meeting with the civic association officers several times and the entire membership last month. They have kept them informed throughout, and they have been open to listening to the neighbors’ concerns. As some of the older residents, they were excited to hear that Mr. Adams was interested in this property, because they worked with his father, Howard Adams, in creating Campden Lakes several years ago. The one concern of the neighbors, which they have shared with Mr. Adams, is the landscaping along the existing homes in the north. The neighbors to the south are very happy with the landscaping plan and restoration of the fence along Bright Road. The previous owners of this site built a lovely home, but it sadly was destroyed in a fire. Other than the original use, what is proposed is a nice use of the property, recognizing that much of the site is undevelopable. Turning those undevelopable areas into an amenity for these anticipated residents, but also for the entire neighborhood, is generous. They defer to the developer and staff’s experience on the architecture, road design and the best lot configuration to address the concerns on the north side. He has seen much enthusiasm for this project. Ms. Call noted that additional public comments were received before the meeting and provided to the Commission. [Commission members confirmed that they had read the public comments.] Commission Discussion Mr. Chinnock stated that he believes this is a very nice use of the site. The developers have come up with a very attractive plan. Although some details need to be worked through with staff, it sounds as though they are very willing to do so. The Commission appreciates their meeting with the neighborhood. The applicant has done a very good job creating a plan that will fit the site in a way that respects the conditions. The greenspace is great. His only comment is that while the inspirational architecture is beautiful, he wants to make sure it blends with the surrounding area. He understands the economics that drive the need for 20 lots, and the applicant’s vision makes sense of the space. Mr. Deschler stated that he is supportive of the proposed use and the proposed building materials. He understands the stormwater management challenges but believes it would be nice if the center court open space were not used for water detention purposes. If it is part of the design, however, he appreciates that it will be hidden by trees. He would recommend efforts be made to alleviate the straight row of houses along the north perimeter. Perhaps if some of those homes can have walkout levels, it would add some variation to the look. Mr. Alexander stated that he is very supportive, even enthused about the plan. He would have enjoyed looking at more design details tonight. The landscape presentation was very impressive. He is supportive of most of what has been proposed. He is less concerned about the architecture matching the surrounding community, because these lots are quite a distance from the existing homes, which were built at a different time. The market is different today, and the architecture of the homes should reflect the time period in which they are built. Creating continuity within the proposed community is more valuable that making linkages to homes that are significant distances Planning and Zoning Commission Meeting Minutes – June 20, 2024 Page 15 of 29 away. The image provided is often used to show communities with shared public space. There is a concern expressed that the center public space be less about stormwater management and more about usable public space. This will be one of the most important components of the project. The architecture should be subordinate to the design of the space. Essentially, that is occurring with the landscape, as well. He likes the proposed theme for the architecture. Mr. Way stated that this is a very exciting proposal, a great example of the City’s Conservation Design Guidelines implemented. This is one of the first developments that has come before the Commission that addresses those guidelines. It takes advantage of a site that is calling out for it. He applauds the applicant for a proposal that is responsive to the sensitive nature of the site. It is attempting to create something unique here through clustering the residential, as opposed to spreading it out. The center greenspace is a valuable piece of this design. He agrees that if it gets taken over by stormwater management, it could go the wrong way. Earlier, he made the observation that if they could eliminate the roadway on one side, they could create more greenspace. He would encourage them to explore that opportunity. The neighbors expressed their concern tonight about the north edge of the site. He would encourage them to preserve those trees and ensure sufficient setback not to impede those efforts. The neighbors have expressed a desire to see more trees and more buffer added to the plan. He is hopeful that the applicant will meet with the neighbors and work out something that will meet that intent. He heard positive comments from the neighbors about the development in general. He believes if the buffer is the only contention, there is opportunity to work that out. He realizes that there are evergreens along Bright Road. Bright Road is about buildings fronting to it. He would hope that as they look at the design of the buildings on the lots, including the garages, that the homes will appear to be fronting Bright Road, not disengaging from it. He believes pulling the buildings to the street and creating an urban design feel to the development could be spectacular. Ms. Harter stated that she is supportive of the proposal, as well. She appreciates that the applicant has met with the East Dublin Civic Association. She would encourage them to keep the green treed look along Bright Road, even the brown fencing. She appreciates the applicant’s efforts to use landscaping with the architecture to create outdoor living areas. The landscaping surprise is a positive element. Ms. Call stated that Dublin is patient. Residents in the Bright Road area have seen applications that were not what was wanted in this particular area. She appreciates seeing an application that is more of what we want in this particular area. She echoes the neighbors’ comments about lot size. While economics are not a consideration of the Planning and Zoning Commission, they are the developer’s reality. She would recommend the developer look for opportunity for lot deletion in the center section (Lots 17-20) and across the back section when they are pulling the lots forward. This is a beautiful project – not what we see every day. The Commission appreciates that! She inquired if there is additional clarification the applicant is seeking. Mr. Kinzelman responded that they appreciate the great comments, all of which are taken under advisement. Ms. Call noted that a vote is taken on some Concept Plans. Mr. Boggs responded that votes are taken only on Concept Plans within the Bridge Street District. Ms. Call stated that tonight’s comments were informal feedback. The Commission looks forward to a future Preliminary Development Plan/Rezoning application for this parcel. BOARD OF ZONING APPEALS BOARD ORDER DECEMBER 16, 1999 CITY OF D[BLI\ Division of Planning 5800 Shier•Rings Road Dublin, Ohio 43016-1136 Phone/TDD:614.761-6550 Fax: 614-161-6566 Web Site: www.dublin.oh.us The Board of Zoning Appeals took the following action at this meeting. 1. Variance 99-1O5V - 4338 Bright Road Location: 15.74 acres located on the north side of Bright Road, approximately 1,600 feet east of Riverside Drive (SR 257). Existing Zoning: R-1, Restricted Suburban Residential District. Request: A variance to Section 153.074 to permit an increase in the permitted size of an accessory structure from 25 percent of the livable area of the principal structure to 33 percent (from 1,819 square feet to 2,400 square feet). Proposed Use: The construction of a 60' x 40' barn (2,400 square feet) to the rear of an existing 7,274 square foot single-family residence. Applicant: Anthony R. Weiher, 4338 Bright Road, Dublin, Ohio 43017. MOTION: To approve this variance with seven conditions: 1) That the use of this accessory structure be clearly defined and limited to storage of the resident's equipment and vehicles, a "hobby" workshop for this residence, and that it cannot be used for living or business purposes, including without limitation, the rehabilitation and sales of automobiles for profit under any circumstances; 2) That water and sewer services not be extended to this building to limit inappropriate reuse in the future; 3) That the two existing accessory buildings be removed from the site prior to issuance of a building permit for the proposed structure; 4) That the accessory structure be screened on all sides by a minimum of 14 evergreen trees (five to six feet in height at installation), subject to staff approval; 5) That if the parcel-would be reduced from 15.74 acres, the variance be rescinded requiring that the approved barn structure be removed from the site; 6) That the variance and these conditions be recorded with the Franklin County Auditor's office, and that the applicant show proof of the recording prior to issuance of building permits; and Page 1 of 2 BOARD OF ZONING APPEALS BOARD ORDER DECEMBER 16, 1999 1. Variance 99-1O5V - 4338 Bright Road (Cont.) 7) That the current attached garage of 650 square feet be converted into living space within twelve months of building the new accessory structure. Glen Aurelius, representing the owner, accepted the above conditions. VOTE: 4-0-1 RESULT: This variance was approved. RECORDED VOTES: Brent Davis Yes Chester Porembski Yes Ruth Meeker Reiss Abstain Amy Salay Yes William Sherman Yes STAFF CERTIFICATION Barbara Clarke Planning Director Page 2 of 2 rr~~ uH~ ~~~ i~i.i~ BOARD OF ZONING APPEALS BOARD ORDER NOVEMBER 18,1999 The Board of Zoning Appeals took the following action at this meeting: 1. Variance 99-1O5V - 4338 Bright Road Location: 15.74 acres located on the north side of Bright Road, approximately 1,600 feet east of Riverside Drive (SR 257). Existing Zoning: R-1, Restricted Suburban Residential District. Request: A variance to Section 153.074 to permit an increase in the permitted size of an accessory structure from 25 percent of the livable area of the principal structure to 33 percent (from 1,819 square feet to 2,400 square feet). Proposed Use: The construction of a 60' x 40' barn (2,400 square feet) to the rear of an existing 7,274 square foot single-family residence. Applicant: Anthony R. Weiher, 4338 Bright Road, Dublin, Ohio 43017. MOTION: To table this variance application for the purpose of 1) examining alternate building materials, 2) submitting a revised landscape plan identifying species size, type, and location, and 3) to notify adjacent property owners. VOTE: 5 - 0 RESULT: This variance application was tabled. RECORDED VOTES: Brent Davis Yes Chester Porembski Yes Ruth Meeker Reiss Yes Amy Salay Yes William Sherman Yes STAFF CERTIFICATION Q~.~a. Barbara Clarke Planning Director 99-1O5V Weiher Residence 4338 Bright Road BOARD OF ZONING APPEALS BOARD ORDER OCTOBER 28, 1999 r~ ~~~~ i~~ iti.i~ The Board of Zoning Appeals took the following action at this meeting: 4. Variance 99-1O5V - 4338 Bright Road Location: 15.74 acres located on the north side of Bright Road, approximately 1,600 feet east of Riverside Drive (SR 257). Existing Zoning: R-1, Restricted Suburban Residential District. Request: A variance to Section 153.074 to permit. an increase in the permitted size of an accessory structure from 25 percent of the livable area of the principal structure to 57 percent from 1,056 square feet to 2,400 square feet). Proposed Use: The construction of a 60' x 40' barn (2,400 square feet) to the rear of an existing 4,227 square foot single-family residence. Applicant: Anthony R. Weiher, 4338 Bright Road, Dublin, Ohio 43017. MOTION: To table this variance application for the purpose of obtaining building permits for existing expansions to the home, to obtain the exact dimensions of any accessory structures (including the pool) to remain on the property, to obtain the accurate distances between accessory structures and property lines, to identify the building materials of the new structure, and to submit a revised site plan. VOTE: 5-0 RESULT: This variance application was tabled. RECORDED VOTES: Brent Davis Yes Chester Porembski Yes Ruth Meeker Reiss Yes Amy Salay Yes William Sherman Yes STAFF CERTIFICATION Barbara M. Clarke Planning Director 1 of 2 EDCA Meeting Tuesday October 29, 2024 Northwest Library, 2280 Hard Rd. 6:00-7:30pm I. Brief welcome – Thank you to the residents in attendance II. 4338 Bright Road Preliminary Development Plan – Presenter: Brian Kinzelman, MKSK a. The plan is slightly reconfigured since last presented. The new configuration retains 20 lots but shifts the lots so there are only 6 (not 7) along the northern property line. b. The eastern portion of the site along Billingsley Run will remain as-is in a natural state without trails. The creek bed will be cleared of necessary debris, as needed, to allow proper water flow. c. The western portion of the site will be a dry basin retention area meant to temporarily hold water during rain events and to capture run-off from the development and from Hanna Hills. d. Trees along the northern and southern property lines will remain intact and be supplemented with additional plantings. e. The fence along the southern property line will be repaired. But, this will not be a fenced or gated community. f. The developer will be finalizing a Planned Unit Development (PUD) text which will detail the site and HOA requirements. This development text is part of the preliminary and final development plan submissions to the City Planning & Zoning Commission. g. See attached slides for the latest preliminary development plan which shall be presented to the Planning & Zoning Commission hopefully at the Nov. 21, 2024 meeting or possibly the December meeting. h. The developer requests that if you have questions or concerns please get those to him (or you can send them to the EDCA for forwarding) as soon as possible so they may be considered before presenting to the Planning & Zoning Commission. i. Prior to the Planning & Zoning meeting, the EDCA will send out the full planning package/details for your review and comment. III. 4163 Bright Road Update a. The property sold at auction on 9/25/24 but not yet recorded on auditor website. b. The winning bid was $407,000 (150 bids). c. The property remains zoned R-1, and the community plan suggests large-lot residential. IV. Bright Road Construction Update a. The utility burial on Bright Rd. complete. b. The Bright Rd. eastbound lanes are now open and handling 2-way traffic as westbound lanes are constructed. c. There will be Do Not Block signage and pavement markings for the entrance to Inverness. d. The Bright Rd. westbound lane construction expected to complete in November. e. The entire project corridor (with improvements on Sawmill Rd.) is expected to complete in fall of 2025. f. The Emerald Parkway roundabout lane construction is complete. g. On a semi-related note, the Mount Carmel landscaping plan includes naturalized areas with no-mow turf and prairie and meadow grasses that will take a few seasons to fully mature, please be patient during this intermediate time. 2 of 2 V. Bright Road Billingsley Bridge Update a. The City is designing a new bridge for Bright Road over Billingsley Creek. The replacement bridge will be wider and include room for pedestrian traffic. b. Construction is planned for 2026. VI. Hard Rd. & Riverside Drive Noise and Traffic Study a. 1st collection of noise and traffic data occurred August 7-8, 2024 b. 2nd collection of noise and traffic data will occur soon (equipment is in place) c. In December, the City will receive a summary of results. d. Additional noise and traffic counts will be recorded in the winter and spring of 2025. VII. Speed Management Program a. The City’s recently approved Capital Improvement Plan (CIP) included more rotating speed signs. b. The City is now using speed warning cameras at three locations. These cameras capture license plates. Starting Sept 16, 2024, the City will issue warning letters via mail to speed violators captured on the cameras. The camera locations will rotate. VIII. Utility Extension a. The only project in the recently adopted 2025-2029 Capital Improvements Plan (CIP) includes water service in Area 3A which is along Riverside Drive from Hard Rd to Wyandotte Woods Blvd. b. Construction is planned for 2026 and will include extension of the shared use path from where the existing pass stops at Tonti up to Wyandotte Woods Boulevard. IX. AltaFiber a. Currently work is wrapping up for the year along Riverside Drive, Orchard Crest/River Knolls, Trails End, Summit View, Wyandotte Woods, Tonti, Hanna Hills, Campden Lakes, Wedgewood Hills, Estates at Scioto Crossing, and the Reserve Condos at Scioto Crossing. b. In 2025, work will occur in the remainder of neighborhoods east of the Scioto River and north of I-270 (Bright Road, MacBeth, Grandee Cliffs, Bryson Cove) c. In late 2025-2026, work will occur on the east side of the Scioto River south of I-270. X. Crime Update – Vehicle Thefts a. This summer, there were several cars stolen reported abandoned in the Conine Drive are off Summit View Road. b. On October 25, Dublin police arrested a 16-year old resident of Conine Drive who confessed to stealing up to 75 vehicles from July 2024 through September 2024. c. Dublin police are working with other jurisdictions to charge the individual. XI. Columbus Fourth Water Plant Transmission Line a. The City of Columbus has selected the preferred alignment which includes a segment that crosses the river along Emerald Parkway and then continues east up Tuller Road, along Dublin Center Drive, and then to Sawmill Road. b. Construction is expected to occur in 2027-2029 XII. Emerald Connector a. There was a public meeting held Sept 12 and the public comment period closed Oct 12, 2024. b. The City has submitted for state and federal funding XIII. Q& A and Conclusion – As always, feel free to reach out will any questions.